FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic (Fragment) OS=Nicotiana tabacum GN=GAPC PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.153e-56
Identity = 107/134 (79.85%), Postives = 113/134 (84.33%), Query Frame = 3
Query:  105 GRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            GRIGRLVARV LQRDDVELVAVNDPFI+TDYMTYM KYDSVHGQWKHHELKVKD+KTLLFGEK V VFG+RNPEEIPWAE GA++VVESTGVFT               V+ISAPSKDAPMFVVGVNE EYKPE
Sbjct:    1 GRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGEKSVRVFGIRNPEEIPWAEAGADFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEKEYKPE 134          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_PETCR (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petroselinum crispum GN=GAPC PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 4.382e-56
Identity = 107/144 (74.31%), Postives = 116/144 (80.56%), Query Frame = 3
Query:   78 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYM KYDSVHGQWK  ELKVKD KTLLFG+KP+TVFGVRNPEE PW E GAEYVVESTGVFT               V+ISAPS +APMFVVGVNE EYK ++
Sbjct:    2 KMKIGINGFGRIGRLVARVALMSDDIELVAVNDPFITTEYMTYMFKYDSVHGQWKKDELKVKDSKTLLFGDKPLTVFGVRNPEEDPWGEAGAEYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSGNAPMFVVGVNEKEYKKDI 145          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_PHYPA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Physcomitrella patens GN=GAPC PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.413e-46
Identity = 88/143 (61.54%), Postives = 106/143 (74.13%), Query Frame = 3
Query:   78 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            K+K+GINGFGRIGRLVARV L+RDD+ELVA+NDPFIT +YMTYM KYDS HGQWK  E+ +  +  L FG  PV V+  R+P EIPW + GA++VVESTGVFT               V+ISAPSKDAPMFV+GVNE++Y  E
Sbjct:    6 KIKVGINGFGRIGRLVARVALERDDIELVAINDPFITPEYMTYMFKYDSTHGQWKKTEVTLHSEGHLTFGGNPVAVYACRDPSEIPWGKHGADFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVMGVNENKYSDE 148          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_HORVU (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic (Fragment) OS=Hordeum vulgare GN=GAPC PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.120e-43
Identity = 85/114 (74.56%), Postives = 89/114 (78.07%), Query Frame = 3
Query:  168 VNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            VNDPFITTDYMTYM KYD+VHGQWKHHE+KVKD KTLLFGEK V VFG RNPEEIPWA  GAEYVVESTGVFT               VIISAPSKDAPMFV GVNE EYK ++
Sbjct:    1 VNDPFITTDYMTYMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVAVFGCRNPEEIPWAAAGAEYVVESTGVFTDKDKAAAHIKGGAKKVIISAPSKDAPMFVCGVNEKEYKSDI 114          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_CRYCU (Glyceraldehyde-3-phosphate dehydrogenase OS=Cryptococcus curvatus GN=GPD PE=3 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 1.850e-38
Identity = 80/141 (56.74%), Postives = 99/141 (70.21%), Query Frame = 3
Query:   84 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            K+GINGFGRIGR+V R  L+  D+++VA+NDPFI  DYM YM KYDS HG++K  +++ KD K ++ G KP++VFG R+P  IPW + GA+YVVESTGVFT               VIISAPS DAPMFV GVN   YKPE
Sbjct:    4 KVGINGFGRIGRIVLRNALEHGDIDVVAINDPFIDLDYMVYMFKYDSTHGRFKG-KVETKDGKLVIEG-KPISVFGERDPAAIPWGKAGADYVVESTGVFTTIEKASLHLKGGAKKVIISAPSADAPMFVCGVNLEAYKPE 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_DEBHA (Glyceraldehyde-3-phosphate dehydrogenase OS=Debaryomyces hansenii GN=GPD PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 3.155e-38
Identity = 78/143 (54.55%), Postives = 99/143 (69.23%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            + IGINGFGRIGRLV R+ LQR D+++VAVNDPFI  +Y  YM KYDS HG++K  E+  KDD  ++ G+  + VFG ++P  IPW + G +YV+ESTGVFT               VII+APS DAPMFVVGVNE +Y P+L
Sbjct:    3 ITIGINGFGRIGRLVLRIALQRSDIKVVAVNDPFIAPEYAAYMFKYDSTHGRYKG-EVTSKDDSLVIDGQS-IKVFGEKDPASIPWGKAGVDYVIESTGVFTTTEGAQKHIDGGAKKVIITAPSSDAPMFVVGVNEQKYTPDL 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_GRAVE (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Gracilaria verrucosa GN=GAPC PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 3.155e-38
Identity = 78/142 (54.93%), Postives = 101/142 (71.13%), Query Frame = 3
Query:   84 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            ++GINGFGRIGRLV R  +++D + +VA+NDPFI  +YM YM K+DS HG++    ++ KD K ++ G K +T++G R+P EIPWAE GA+YVVESTGVFT               VIISAPSKDAPMFV GVNE +Y P+L
Sbjct:    5 QVGINGFGRIGRLVLRAAIEKDTMSVVAINDPFIDLEYMAYMFKFDSTHGRYAG-SVETKDGKLIVNG-KSITIYGHRDPAEIPWAEAGADYVVESTGVFTLKEKAEKHFTGGAKKVIISAPSKDAPMFVCGVNEDKYTPDL 144          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_CRYNE (Glyceraldehyde-3-phosphate dehydrogenase OS=Cryptococcus neoformans GN=GPD PE=3 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 2.045e-37
Identity = 81/142 (57.04%), Postives = 95/142 (66.90%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            VK+GINGFGRIGR+V R  ++  D+E+VAVNDPFI  DYM YM KYDS HG++K   ++VKD K L    K + VFG ++P  I W E GAEYVVESTGVFT               V+ISAPS DAPMFV GVN   YKPE
Sbjct:    3 VKVGINGFGRIGRIVLRNAIEHGDLEVVAVNDPFIDLDYMVYMFKYDSTHGRFKG-SVEVKDGK-LYINNKAIAVFGEKDPANIKWGEAGAEYVVESTGVFTTTEKAGVHLKGGAKKVVISAPSADAPMFVCGVNLDAYKPE 142          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_CANAL (Glyceraldehyde-3-phosphate dehydrogenase OS=Candida albicans GN=TDH1 PE=1 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 2.045e-37
Identity = 80/143 (55.94%), Postives = 97/143 (67.83%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            +KIGINGFGRIGRLV RV L R D+E+VAVNDPFI  DY  YM KYDS HG++K  E+    D  ++ G K + VF  R+P  IPW ++G +YV+ESTGVFT               VII+APS DAPMFVVGVNE +Y P+L
Sbjct:    3 IKIGINGFGRIGRLVLRVALGRKDIEVVAVNDPFIAPDYAAYMFKYDSTHGRYK-GEVTASGDDLVIDGHK-IKVFQERDPANIPWGKSGVDYVIESTGVFTKVEGAQKHIDAGAKKVIITAPSADAPMFVVGVNEDKYTPDL 143          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_OMPOL (Glyceraldehyde-3-phosphate dehydrogenase OS=Omphalotus olearius GN=GPD PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 3.488e-37
Identity = 81/141 (57.45%), Postives = 96/141 (68.09%), Query Frame = 3
Query:   81 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKP 503
            VK+GINGFGRIGRLV R  L+   VE+VAVNDPFI  DYM YM K+DSVHG++K   ++ KD K ++ G KP+ VFG R+P  IPW  +GA+YVVESTGVFT               VIISAPS DAPM+V GVN   Y P
Sbjct:    3 VKVGINGFGRIGRLVIRNALEAQGVEVVAVNDPFIPLDYMVYMFKFDSVHGRYK-GTVEAKDGKLIIAG-KPIAVFGERDPASIPWGASGADYVVESTGVFTTIDKASAHLKGGAKKVIISAPSADAPMYVCGVNLDAYDP 141          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3PC_TOBAC1.153e-5679.85Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_PETCR4.382e-5674.31Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_PHYPA1.413e-4661.54Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_HORVU1.120e-4374.56Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3P_CRYCU1.850e-3856.74Glyceraldehyde-3-phosphate dehydrogenase OS=Crypto... [more]
G3P_DEBHA3.155e-3854.55Glyceraldehyde-3-phosphate dehydrogenase OS=Debary... [more]
G3PC_GRAVE3.155e-3854.93Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3P_CRYNE2.045e-3757.04Glyceraldehyde-3-phosphate dehydrogenase OS=Crypto... [more]
G3P_CANAL2.045e-3755.94Glyceraldehyde-3-phosphate dehydrogenase OS=Candid... [more]
G3P_OMPOL3.488e-3757.45Glyceraldehyde-3-phosphate dehydrogenase OS=Omphal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top