FC876228

Overview
NameFC876228
Unique NameFC876228
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length459
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB11_ARATH (U-box domain-containing protein 11 OS=Arabidopsis thaliana GN=PUB11 PE=2 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 1.078e-14
Identity = 39/78 (50.00%), Postives = 53/78 (67.95%), Query Frame = 3
Query:  117 DRVKVDMATQFPDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLISNF 350
            D  K       P DF CP+SLE+M DPVI+++G T++RA IQRW+D G+ TCP T+  L +  +L PN+ LRSLIS +
Sbjct:  231 DESKKSDKLTIPVDFLCPVSLELMKDPVIVATGQTYERAYIQRWIDCGNLTCPKTQQKL-ENFTLTPNYVLRSLISRW 307          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB10_ARATH (U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.408e-14
Identity = 40/78 (51.28%), Postives = 55/78 (70.51%), Query Frame = 3
Query:  117 DRVKVDMATQFPDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLISNF 350
            D  K D  T  P+DF CPISLE+M DP I+S+G T++R+ IQRW+D G+ +CP T+  L +  +L PN+ LRSLIS +
Sbjct:  234 DSQKSDNLT-IPEDFLCPISLELMKDPAIVSTGQTYERSFIQRWIDCGNLSCPKTQQKL-ENFTLTPNYVLRSLISQW 309          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB22_ARATH (U-box domain-containing protein 22 OS=Arabidopsis thaliana GN=PUB22 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.839e-14
Identity = 42/94 (44.68%), Postives = 58/94 (61.70%), Query Frame = 3
Query:  129 VDMATQFPDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHR-TCPITKLPLPDQPSLIPNHALRSLISNF---------TRTPLPKPQL 380
            +D   + P  F CPISL+IM DPVI+S+G T+DR SI++WL SG + +CP+TK  +  +  L PNH LR LI ++          R P PKP +
Sbjct:    1 MDQEIEIPSFFLCPISLDIMKDPVIVSTGITYDRESIEKWLFSGKKNSCPVTKQVI-TETDLTPNHTLRRLIQSWCTLNASYGIERIPTPKPPI 93          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB4_ARATH (U-box domain-containing protein 4 OS=Arabidopsis thaliana GN=PUB4 PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 2.402e-14
Identity = 40/98 (40.82%), Postives = 65/98 (66.33%), Query Frame = 3
Query:  156 DFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLISNFTRTPLPKPQLEHANPNPQTLISVLTSKSSPLES 449
            DF CP+SLE+M+DPVI+SSG T+++A I+RW+D G + CP T+  L    +LIPN+ +++LI+N+  T      ++  +PN  T ++ L+   S  +S
Sbjct:  233 DFFCPLSLEVMTDPVIVSSGQTYEKAFIKRWIDLGLKVCPKTRQTL-THTTLIPNYTVKALIANWCET----NDVKLPDPNKSTSLNELSPLLSCTDS 325          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB23_ARATH (U-box domain-containing protein 23 OS=Arabidopsis thaliana GN=PUB23 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 3.138e-14
Identity = 42/94 (44.68%), Postives = 58/94 (61.70%), Query Frame = 3
Query:  129 VDMATQFPDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHR-TCPITKLPLPDQPSLIPNHALRSLISNF---------TRTPLPKPQL 380
            +D   + P  F CPISLEIM DPVI+S+G T+DR SI++WL +G + +CP+TK  + D   L PNH LR LI ++          R P P+P +
Sbjct:    6 MDEEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFAGKKNSCPVTKQDITD-ADLTPNHTLRRLIQSWCTLNASYGVERIPTPRPPI 98          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB20_ARATH (U-box domain-containing protein 20 OS=Arabidopsis thaliana GN=PUB20 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 4.098e-14
Identity = 42/111 (37.84%), Postives = 63/111 (56.76%), Query Frame = 3
Query:   33 MKLKISXXXXXXXVSKNLINPSRVSCVRDRVKVDMATQFPDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLISNFTRTPL 365
            M L +        VSK  I P  V+   + V++ +    P  F CPIS E+M DPVI++SG T+DR +I++W +SG++TCP+T   L      IPNH +R +I  +  + L
Sbjct:    1 MGLSLRVRRRGGSVSKKEIIP--VTSCSEEVEITI----PSQFQCPISYELMKDPVIIASGITYDRENIEKWFESGYQTCPVTNTVLTSLEQ-IPNHTIRRMIQGWCGSSL 104          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB9_ARATH (U-box domain-containing protein 9 OS=Arabidopsis thaliana GN=PUB9 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 5.352e-14
Identity = 34/69 (49.28%), Postives = 50/69 (72.46%), Query Frame = 3
Query:  150 PDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLISNFTR 356
            P++F CP+S E+M DPV+L+SG T+D+  IQ+WL SG+RTCP T+  LP   +L PN  +R +IS + +
Sbjct:   75 PEEFRCPLSNELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQVLP-HTALTPNLLIREMISKWCK 142          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB21_ARATH (U-box domain-containing protein 21 OS=Arabidopsis thaliana GN=PUB21 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 5.352e-14
Identity = 34/69 (49.28%), Postives = 50/69 (72.46%), Query Frame = 3
Query:  150 PDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLP--DQPSLIPNHALRSLISNF 350
            P +F CPIS+++M DPVI+S+G T+DR SI+ W++SG++TCP+T   L   DQ   IPNH +R +I  +
Sbjct:   32 PPEFQCPISIDLMKDPVIISTGITYDRVSIETWINSGNKTCPVTNTVLTTFDQ---IPNHTIRKMIQGW 97          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB16_ARATH (U-box domain-containing protein 16 OS=Arabidopsis thaliana GN=PUB16 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 5.352e-14
Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 3
Query:  150 PDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLI 341
            P DF CPI+LE+M DPV++++G T+DR SI  W+ SGH TCP T   L    SL+PN AL++LI
Sbjct:  275 PADFRCPITLELMRDPVVVATGQTYDRESIDLWIQSGHNTCPKTGQVL-KHTSLVPNRALKNLI 337          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB3_ARATH (U-box domain-containing protein 3 OS=Arabidopsis thaliana GN=PUB3 PE=2 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 1.557e-13
Identity = 37/89 (41.57%), Postives = 57/89 (64.04%), Query Frame = 3
Query:  102 VSCVRDRV------KVDMATQFPDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLISNF 350
            V C+R+ +      +V      P  F CP+S E+M DPVI++SG TFDR SI++WLD+G   CP T+  L  Q  LIPN+ ++++I+++
Sbjct:  217 VLCIREHMLKTEFLEVAKGISIPPYFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLAVCPRTRQVLTHQ-ELIPNYTVKAMIASW 304          
The following BLAST results are available for this feature:
BLAST of FC876228 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
PUB11_ARATH1.078e-1450.00U-box domain-containing protein 11 OS=Arabidopsis ... [more]
PUB10_ARATH1.408e-1451.28U-box domain-containing protein 10 OS=Arabidopsis ... [more]
PUB22_ARATH1.839e-1444.68U-box domain-containing protein 22 OS=Arabidopsis ... [more]
PUB4_ARATH2.402e-1440.82U-box domain-containing protein 4 OS=Arabidopsis t... [more]
PUB23_ARATH3.138e-1444.68U-box domain-containing protein 23 OS=Arabidopsis ... [more]
PUB20_ARATH4.098e-1437.84U-box domain-containing protein 20 OS=Arabidopsis ... [more]
PUB9_ARATH5.352e-1449.28U-box domain-containing protein 9 OS=Arabidopsis t... [more]
PUB21_ARATH5.352e-1449.28U-box domain-containing protein 21 OS=Arabidopsis ... [more]
PUB16_ARATH5.352e-1454.69U-box domain-containing protein 16 OS=Arabidopsis ... [more]
PUB3_ARATH1.557e-1341.57U-box domain-containing protein 3 OS=Arabidopsis t... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A09EF DevOvary1 Citrus clementina cDNA clone C32002A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876228 ID=FC876228|Name=FC876228|organism=Citrus clementina|type=EST|length=459bp
AGATAGGGGTCCTGCATTTGCTGGACAGATAGATGAAACTGAAAATCTCA
TAGGCAGCAGCAGCGGCAGCAGTTTCCAAAAACCTCATAAACCCCTCTCG
AGTTAGCTGTGTTCGAGACCGAGTCAAAGTAGATATGGCGACTCAGTTCC
CGGACGATTTCAATTGTCCGATTTCTCTAGAAATAATGTCCGACCCGGTC
ATACTCTCCTCTGGCCACACCTTTGACCGAGCGTCAATCCAACGGTGGCT
GGACTCCGGTCACCGTACTTGTCCAATTACTAAACTACCCCTCCCTGACC
AACCCTCTCTTATCCCCAACCACGCTCTGAGATCTTTAATTTCCAATTTT
ACCCGCACCCCATTACCGAAACCACAGCTCGAACACGCAAACCCGAACCC
ACAAACCCTAATCTCCGTGCTCACATCAAAATCTTCCCCTCTCGAGTCCA
AACTCGAGT
back to top