FC876313

Overview
NameFC876313
Unique NameFC876313
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length714
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10228 contig Ccv1_Contig10228:4..717. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_CHLRE (Oxygen-evolving enhancer protein 1, chloroplastic OS=Chlamydomonas reinhardtii GN=PSBO PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.414e-29
Identity = 65/131 (49.62%), Postives = 83/131 (63.36%), Query Frame = 3
Query:  324 ATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFA-FKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            A +A  ++ A   G    LT+DEIQ  TY++VKG+G AN CP ++ G  +    K G Y+ + FC+EPTSFTVK E   K    +F  TKLMTRLTYTLD + G F+V  DG+ +  E DGIDYAA T QL
Sbjct:   34 AAAAAALATAMVAGSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTVKEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQL 164          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_EUGGR (Oxygen-evolving enhancer protein 1, chloroplastic OS=Euglena gracilis GN=PSBO PE=1 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 1.912e-26
Identity = 65/138 (47.10%), Postives = 81/138 (58.70%), Query Frame = 3
Query:  306 IAGFALATSALVVSGASAEGV-PKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDS-FAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            +AG   A  A ++  A A       LTYDE+QS +Y+EVK +G A  CP +  GV S  + K GKY+   +CLEP+SF VK     K    +F+ TKLMTRLTYTLD I     V  DG+    EKDG+DYAA T QL
Sbjct:   71 LAGAGRAMGAALIGAAVAGSANAASLTYDELQSLSYLEVKSSGIAGTCPVLADGVSSKLSLKAGKYEINNWCLEPSSFQVKLPPTEKQQVTEFERTKLMTRLTYTLDAISADLNVGGDGSWTIQEKDGLDYAATTVQL 208          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_THEEB (Photosystem II manganese-stabilizing polypeptide OS=Thermosynechococcus elongatus (strain BP-1) GN=psbO PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.467e-18
Identity = 47/108 (43.52%), Postives = 71/108 (65.74%), Query Frame = 3
Query:  396 QSKTYMEVKGTGTANQCPTIDGGV-DSFAFKPGK-YQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            Q+ TY ++ GTG AN+CPT+D     ++     + Y+  + CL+PT+F VK E  NK    +F  TKL+TR T +LD+I+G  +V+ DG++ FVE+DGID+  VT Q+
Sbjct:   29 QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQM 136          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_SYNEN (Photosystem II manganese-stabilizing polypeptide OS=Synechococcus elongatus naegeli GN=psbO PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.467e-18
Identity = 47/108 (43.52%), Postives = 71/108 (65.74%), Query Frame = 3
Query:  396 QSKTYMEVKGTGTANQCPTIDGGV-DSFAFKPGK-YQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            Q+ TY ++ GTG AN+CPT+D     ++     + Y+  + CL+PT+F VK E  NK    +F  TKL+TR T +LD+I+G  +V+ DG++ FVE+DGID+  VT Q+
Sbjct:   29 QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQM 136          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_ANASP (Photosystem II manganese-stabilizing polypeptide OS=Anabaena sp. (strain PCC 7120) GN=psbO PE=3 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 1.242e-17
Identity = 46/107 (42.99%), Postives = 66/107 (61.68%), Query Frame = 3
Query:  405 TYMEVKGTGTANQCP----TIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            TY +++GTG AN+CP    T  G +   + K   Y  K+ CLEPT+F VK E  NK    +F   KL+TR T T+D++ G  + + D ++ FVEKDG+D+ A+T QL
Sbjct:   34 TYEQIRGTGLANKCPQLTETSRGSIPLDSSK--SYVLKELCLEPTNFFVKEEPANKRQTAEFVAGKLLTRYTSTIDQVSGDLKFNDDSSLTFVEKDGLDFQAITVQL 138          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_CYAA5 (Photosystem II manganese-stabilizing polypeptide OS=Cyanothece sp. (strain ATCC 51142) GN=psbO PE=3 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.285e-14
Identity = 45/108 (41.67%), Postives = 59/108 (54.63%), Query Frame = 3
Query:  396 QSKTYMEVKGTGTANQCPTIDGGV-DSFAFKPGK-YQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            Q  TY E+  TG AN+CP I      S   +PG+ Y     CLEP  + VK E VNK    ++   KL+TR T +L++I G   V  DG + F E+ GID+  VT QL
Sbjct:   32 QDLTYDEILNTGLANKCPQISEFTRGSIPIEPGQTYFVDDLCLEPQEYFVKEEPVNKRQEAEYVPGKLLTRYTTSLEQISGKITVDEDGVVTFYEEGGIDFQPVTVQL 139          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_SYNY3 (Photosystem II manganese-stabilizing polypeptide OS=Synechocystis sp. (strain PCC 6803) GN=psbO PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.740e-14
Identity = 42/105 (40.00%), Postives = 58/105 (55.24%), Query Frame = 3
Query:  405 TYMEVKGTGTANQCPTIDGGV-DSFAFKPG-KYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            TY ++  TG AN CP I      +   +P  KY    FC+EP  + VK E VNK    ++   K++TR T +L++I G   V  DGT+ F EKDGID+  +T  L
Sbjct:   35 TYDDIVNTGLANVCPEISSFTRGTIEVEPNTKYFVSDFCMEPQEYFVKEEPVNKRQKAEYVKGKVLTRQTTSLEQIRGSIAVGADGTLTFKEKDGIDFQPITVLL 139          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_SYNE7 (Photosystem II manganese-stabilizing polypeptide OS=Synechococcus elongatus (strain PCC 7942) GN=psbO PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.088e-13
Identity = 42/113 (37.17%), Postives = 63/113 (55.75%), Query Frame = 3
Query:  381 TYDEIQSKTYMEVKGTGTANQCPTI-DGGVDSFAFKPGK-YQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            T  ++ + TY ++K TG AN+C ++ +    +   + GK Y     CLEP  F VK E  NK    +F   K++TR T +LD++ G   +  DGT+ F EK GID+ A+T  L
Sbjct:   26 TAADLGTLTYDQIKDTGLANKCLSLKESARGTIPLEAGKKYALTDLCLEPQEFFVKEEPGNKRQKAEFVPGKVLTRYTSSLDQVYGDLALKADGTVSFTEKGGIDFQAITVLL 138          
The following BLAST results are available for this feature:
BLAST of FC876313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
PSBO_CHLRE1.414e-2949.62Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_EUGGR1.912e-2647.10Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_THEEB1.467e-1843.52Photosystem II manganese-stabilizing polypeptide O... [more]
PSBO_SYNEN1.467e-1843.52Photosystem II manganese-stabilizing polypeptide O... [more]
PSBO_ANASP1.242e-1742.99Photosystem II manganese-stabilizing polypeptide O... [more]
PSBO_CYAA51.285e-1441.67Photosystem II manganese-stabilizing polypeptide O... [more]
PSBO_SYNY33.740e-1440.00Photosystem II manganese-stabilizing polypeptide O... [more]
PSBO_SYNE71.088e-1337.17Photosystem II manganese-stabilizing polypeptide O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003C05EF DevOvary1 Citrus clementina cDNA clone C32003C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876313 ID=FC876313|Name=FC876313|organism=Citrus clementina|type=EST|length=714bp
GCCTCCACATACAAAACAAGTAATCCTCTGTAAAGAGTTTAGTTTGTTTC
TTAGAAGATAAAGGGATACTAGCAAGTAACCCACAAGTGGTAGGGAGCAA
GATGGCAGCCTCGTTACAAGCCGCAGCTACACTGATGCAACCCACCAAGG
TGGGTGTGGTACCCGCTCGCAGCAGCAGCCTGCAGCTGAGGTCTTCACAG
AGCGTTTCGAAGGCTTTTGGTGTCGACTCAGCTGGTGCTAGGATCTCTTG
CTCTTTGAATAATGACTTGAAGGATTTGGCTCAGAAATGTGTTGATGCTA
CCAAGATCGCTGGCTTTGCCCTCGCCACTTCTGCTCTCGTCGTTTCGGGA
GCAAGTGCTGAAGGTGTTCCAAAGAGGCTAACCTATGATGAAATCCAGAG
CAAGACATACATGGAAGTGAAGGGAACCGGAACTGCTAACCAGTGCCCAA
CCATTGATGGCGGAGTTGACTCTTTTGCCTTCAAACCTGGCAAATACCAG
GCTAAGAAGTTCTGCCTAGAACCAACTTCCTTCACTGTCAAGGCTGAGGG
TGTCAACAAGAATGCCCCACCAGATTTCCAGAACACCAAGCTCATGACCC
GCCTTACCTACACCCTTGACGAGATTGAGGGACCTTTTGAAGTGTCCCCC
GATGGCACCATTAAGTTTGTGGAGAAGGATGGAATTGACTATGCTGCTGT
GACAGNTCAGCTGG
back to top