FC876316

Overview
NameFC876316
Unique NameFC876316
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length298
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:13..310. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS3_SOYBN (Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.082e-33
Identity = 65/84 (77.38%), Postives = 77/84 (91.67%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M +V+EIRNAQRA+GPATV+AIGTATP +  +Q+ YPDYYFRIT SEHMTELKEKF+RMCDKSMIKKR+M+L EEILKENP++C
Sbjct:    1 MVSVEEIRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS2_CAMSI (Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.082e-33
Identity = 65/84 (77.38%), Postives = 76/84 (90.48%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M TV+E+R AQRA+GPATV+AIGTATP +  +Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKR+M+LTEEILKENPN+C
Sbjct:    1 MVTVEEVRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMYLTEEILKENPNVC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS1_CASGL (Chalcone synthase OS=Casuarina glauca GN=CHS1 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.082e-33
Identity = 66/84 (78.57%), Postives = 76/84 (90.48%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M TV+E+R AQRA+GPATVLAIGTATP +  +Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKR+M+LTEEILKE+PNMC
Sbjct:    1 MVTVEEVRKAQRAEGPATVLAIGTATPPNCLDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMYLTEEILKEHPNMC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSB_PEA (Chalcone synthase 1B OS=Pisum sativum GN=CHS-1B PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.413e-33
Identity = 66/84 (78.57%), Postives = 75/84 (89.29%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M TV EIR AQ+A+GPATVLAIGTATP +  +Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKR+MHLTEEILKENP++C
Sbjct:    1 MVTVDEIRQAQKAEGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMHLTEEILKENPSVC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS8_BROFI (Chalcone synthase 8 OS=Bromheadia finlaysoniana GN=CHS8 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.413e-33
Identity = 65/81 (80.25%), Postives = 76/81 (93.83%), Query Frame = 1
Query:   55 VQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            ++EIR AQRA+GPA VLAIGT+TP ++  QADYPDYYFRITKSEH+TELKEKF+RMCDKSMIKKR+M+LTEEILKENPN+C
Sbjct:    5 MEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNIC 85          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS4_BROFI (Chalcone synthase 4 OS=Bromheadia finlaysoniana GN=CHS4 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.413e-33
Identity = 65/81 (80.25%), Postives = 76/81 (93.83%), Query Frame = 1
Query:   55 VQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            ++EIR AQRA+GPA VLAIGT+TP ++  QADYPDYYFRITKSEH+TELKEKF+RMCDKSMIKKR+M+LTEEILKENPN+C
Sbjct:    5 MEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNIC 85          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS3_BROFI (Chalcone synthase 3 OS=Bromheadia finlaysoniana GN=CHS3 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.413e-33
Identity = 65/81 (80.25%), Postives = 76/81 (93.83%), Query Frame = 1
Query:   55 VQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            ++EIR AQRA+GPA VLAIGT+TP ++  QADYPDYYFRITKSEH+TELKEKF+RMCDKSMIKKR+M+LTEEILKENPN+C
Sbjct:    5 MEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNIC 85          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS1_CITSI (Chalcone synthase 1 OS=Citrus sinensis GN=CHS1 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.413e-33
Identity = 64/84 (76.19%), Postives = 75/84 (89.29%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M TV E+R AQRA GPAT++AIGTATP +  +Q+ YPDYYFRIT SEHMT+LKEKF+RMCDKSMIKKR+M+LTEEILKENPN+C
Sbjct:    1 MVTVDEVRKAQRAQGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCDKSMIKKRYMYLTEEILKENPNVC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS4_IPOBA (Chalcone synthase LF4 OS=Ipomoea batatas GN=CHS-LF4 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 1.845e-33
Identity = 64/84 (76.19%), Postives = 74/84 (88.10%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M TV+E+R AQRA+GPAT+LAIGT TPA+  NQ+ YPDYYFRIT SEH TELKE+F+RMCDKSMI KR+MHLTEEILKENP+ C
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKERFQRMCDKSMITKRYMHLTEEILKENPSFC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSD_IPONI (Chalcone synthase D OS=Ipomoea nil GN=CHSD PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.410e-33
Identity = 63/84 (75.00%), Postives = 76/84 (90.48%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M TV+E+R AQRA+GPAT+LAIGTATPA+  +Q+ YPDYYFRIT S+HMT+LK+KF+RMCDKSMI KR+MHLTEEILKENP+ C
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITNSDHMTDLKQKFQRMCDKSMITKRYMHLTEEILKENPSFC 84          
The following BLAST results are available for this feature:
BLAST of FC876316 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 140
Match NameE-valueIdentityDescription
CHS3_SOYBN1.082e-3377.38Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV... [more]
CHS2_CAMSI1.082e-3377.38Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 P... [more]
CHS1_CASGL1.082e-3378.57Chalcone synthase OS=Casuarina glauca GN=CHS1 PE=2... [more]
CHSB_PEA1.413e-3378.57Chalcone synthase 1B OS=Pisum sativum GN=CHS-1B PE... [more]
CHS8_BROFI1.413e-3380.25Chalcone synthase 8 OS=Bromheadia finlaysoniana GN... [more]
CHS4_BROFI1.413e-3380.25Chalcone synthase 4 OS=Bromheadia finlaysoniana GN... [more]
CHS3_BROFI1.413e-3380.25Chalcone synthase 3 OS=Bromheadia finlaysoniana GN... [more]
CHS1_CITSI1.413e-3376.19Chalcone synthase 1 OS=Citrus sinensis GN=CHS1 PE=... [more]
CHS4_IPOBA1.845e-3376.19Chalcone synthase LF4 OS=Ipomoea batatas GN=CHS-LF... [more]
CHSD_IPONI2.410e-3375.00Chalcone synthase D OS=Ipomoea nil GN=CHSD PE=2 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003C08EF DevOvary1 Citrus clementina cDNA clone C32003C08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876316 ID=FC876316|Name=FC876316|organism=Citrus clementina|type=EST|length=298bp
ACCAAGCACGAGCCACCCACATATTCATTAAGGGTTCAACTTGAAATGGC
AACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGCCACCG
TCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGCCAACCAGGCTGAT
TATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACGGAGCT
TAAAGAGAAGTTCAGGCGCATGTGTGACAAGTCGATGATTAAGAAGCGCC
ACATGCACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGTGCG
back to top