FC876316

Overview
NameFC876316
Unique NameFC876316
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length298
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:13..310. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSA_PETHY (Chalcone synthase A OS=Petunia hybrida GN=CHSA PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.148e-33
Identity = 64/84 (76.19%), Postives = 75/84 (89.29%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M TV+E R AQRA+GPATV+AIGTATP +  +Q+ YPDYYFRIT SEH T+LKEKF+RMC+KSMIKKR+MHLTEEILKENP+MC
Sbjct:    1 MVTVEEYRKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIKKRYMHLTEEILKENPSMC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS1_MAIZE (Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.148e-33
Identity = 64/82 (78.05%), Postives = 73/82 (89.02%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            TV E+R  QRA GPATVLAIGTATPA+   QADYPDYYFRITKS+H+T+LKEKF+RMCDKSMI+KR+MHLTEE L ENP+MC
Sbjct:    7 TVDEVRKGQRATGPATVLAIGTATPANCVYQADYPDYYFRITKSDHLTDLKEKFKRMCDKSMIRKRYMHLTEEFLSENPSMC 88          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS1_GERHY (Chalcone synthase 1 OS=Gerbera hybrida GN=CHS1 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.148e-33
Identity = 63/81 (77.78%), Postives = 75/81 (92.59%), Query Frame = 1
Query:   55 VQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            ++ IR+AQRA+GPAT+LAIGTATPA+   QADYPDYYFRITKSEHM +LKEKF+RMCDKSMI+KR+MH+TEE LK+NPNMC
Sbjct:    7 MKAIRDAQRAEGPATILAIGTATPANCVYQADYPDYYFRITKSEHMVDLKEKFKRMCDKSMIRKRYMHITEEYLKQNPNMC 87          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSY_RAPSA (Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 4.111e-33
Identity = 64/83 (77.11%), Postives = 73/83 (87.95%), Query Frame = 1
Query:   49 ATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            +++ EIR AQRADGPA +LAIGTA PA+   QA+YPDYYFRIT SEHMT+LKEKF+RMCDKS I+KRHMHLTEE LKENPNMC
Sbjct:    6 SSLDEIRKAQRADGPAGILAIGTANPANHVLQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKENPNMC 88          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS5_SOYBN (Chalcone synthase 5 OS=Glycine max GN=CHS5 PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 5.369e-33
Identity = 64/84 (76.19%), Postives = 76/84 (90.48%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M +V+EIR AQRA+GPATV+AIGTATP +  +Q+ YPDYYFRIT SEHMTELKEKF+RMCDKSMIKKR+M+L EEILKENP++C
Sbjct:    1 MVSVEEIRQAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS2_SOYBN (Chalcone synthase 2 OS=Glycine max GN=CHS2 PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 5.369e-33
Identity = 64/84 (76.19%), Postives = 76/84 (90.48%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M +V+EIR AQRA+GPATV+AIGTATP +  +Q+ YPDYYFRIT SEHMTELKEKF+RMCDKSMIKKR+M+L EEILKENP++C
Sbjct:    1 MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS1_SOYBN (Chalcone synthase 1 OS=Glycine max GN=CHS1 PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 5.369e-33
Identity = 64/84 (76.19%), Postives = 76/84 (90.48%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M +V+EIR AQRA+GPATV+AIGTATP +  +Q+ YPDYYFRIT SEHMTELKEKF+RMCDKSMIKKR+M+L EEILKENP++C
Sbjct:    1 MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSY_MATIN (Chalcone synthase OS=Matthiola incana GN=CHS PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 9.158e-33
Identity = 63/82 (76.83%), Postives = 72/82 (87.80%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            ++ EIR AQRADGPA +L IGTA PA+   QA+YPDYYFRIT SEHMT+LKEKF+RMCDKSMI+KRHMHLTE+ LKENPNMC
Sbjct:    7 SLDEIRKAQRADGPAGILGIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFQRMCDKSMIRKRHMHLTEDFLKENPNMC 88          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS3_SINAL (Chalcone synthase 3 OS=Sinapis alba GN=CHS3 PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 9.158e-33
Identity = 63/83 (75.90%), Postives = 73/83 (87.95%), Query Frame = 1
Query:   49 ATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            +++ EIR AQRADGPA +LAIGTA PA+   QA+YPDYYFRIT SEHMT+LKEKF+RMCDKS I+KRHMHLTEE LK+NPNMC
Sbjct:    7 SSLDEIRKAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKDNPNMC 89          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS3_GERHY (Chalcone synthase 3 OS=Gerbera hybrida GN=CHS3 PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 9.158e-33
Identity = 62/81 (76.54%), Postives = 74/81 (91.36%), Query Frame = 1
Query:   55 VQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            V+ IR AQRA+GPAT+LAIGTATPA+   QADYPDYYFR+T+SEHM +LKEKF+RMCDKSMI+KR+MH+TEE LKENP+MC
Sbjct:   10 VETIRKAQRAEGPATILAIGTATPANCVYQADYPDYYFRVTESEHMVDLKEKFQRMCDKSMIRKRYMHITEEFLKENPSMC 90          
The following BLAST results are available for this feature:
BLAST of FC876316 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 140
Match NameE-valueIdentityDescription
CHSA_PETHY3.148e-3376.19Chalcone synthase A OS=Petunia hybrida GN=CHSA PE=... [more]
CHS1_MAIZE3.148e-3378.05Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV... [more]
CHS1_GERHY3.148e-3377.78Chalcone synthase 1 OS=Gerbera hybrida GN=CHS1 PE=... [more]
CHSY_RAPSA4.111e-3377.11Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 ... [more]
CHS5_SOYBN5.369e-3376.19Chalcone synthase 5 OS=Glycine max GN=CHS5 PE=3 SV... [more]
CHS2_SOYBN5.369e-3376.19Chalcone synthase 2 OS=Glycine max GN=CHS2 PE=3 SV... [more]
CHS1_SOYBN5.369e-3376.19Chalcone synthase 1 OS=Glycine max GN=CHS1 PE=3 SV... [more]
CHSY_MATIN9.158e-3376.83Chalcone synthase OS=Matthiola incana GN=CHS PE=2 ... [more]
CHS3_SINAL9.158e-3375.90Chalcone synthase 3 OS=Sinapis alba GN=CHS3 PE=2 S... [more]
CHS3_GERHY9.158e-3376.54Chalcone synthase 3 OS=Gerbera hybrida GN=CHS3 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003C08EF DevOvary1 Citrus clementina cDNA clone C32003C08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876316 ID=FC876316|Name=FC876316|organism=Citrus clementina|type=EST|length=298bp
ACCAAGCACGAGCCACCCACATATTCATTAAGGGTTCAACTTGAAATGGC
AACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGCCACCG
TCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGCCAACCAGGCTGAT
TATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACGGAGCT
TAAAGAGAAGTTCAGGCGCATGTGTGACAAGTCGATGATTAAGAAGCGCC
ACATGCACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGTGCG
back to top