FC876316

Overview
NameFC876316
Unique NameFC876316
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length298
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:13..310. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS1_SINAL (Chalcone synthase 1 OS=Sinapis alba GN=CHS1 PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 9.158e-33
Identity = 63/83 (75.90%), Postives = 73/83 (87.95%), Query Frame = 1
Query:   49 ATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            +++ EIR AQRADGPA +LAIGTA PA+   QA+YPDYYFRIT SEHMT+LKEKF+RMCDKS I+KRHMHLTEE LK+NPNMC
Sbjct:    7 SSLDEIRKAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKDNPNMC 89          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSA_PEA (Chalcone synthase 1A OS=Pisum sativum GN=CHS-1A PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.196e-32
Identity = 64/84 (76.19%), Postives = 73/84 (86.90%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M TV EIR AQRA+GPATV AIGTATP +   Q+ YPD+YFRIT S+H TELKEKF+RMCDKSMIKKR+MHLTEEILKENP++C
Sbjct:    1 MVTVNEIRQAQRAEGPATVFAIGTATPQNCVEQSTYPDFYFRITNSQHKTELKEKFQRMCDKSMIKKRYMHLTEEILKENPSLC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSY_CARAN (Chalcone synthase OS=Cardamine amara GN=CHS PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.562e-32
Identity = 63/82 (76.83%), Postives = 72/82 (87.80%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            ++ EIR AQRADGPA +LAIGTA PA+   QA+YPDYYFRIT SEHMT+LKEKF+RMCDKS I+KRHMH+TEE LKENPNMC
Sbjct:    8 SLDEIRKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHVTEEFLKENPNMC 89          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSE_IPONI (Chalcone synthase E OS=Ipomoea nil GN=CHSE PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 2.040e-32
Identity = 61/84 (72.62%), Postives = 75/84 (89.29%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M TV+E+R AQRA GPAT++AIGT+TP +  +Q+ YPDYYFRIT SEH+ ELKEKF+RMC+KSMIKKR+M+LTEEILKENPN+C
Sbjct:    1 MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMIKKRYMYLTEEILKENPNIC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS1_CAMSI (Chalcone synthase 1 OS=Camellia sinensis GN=CHS1 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.665e-32
Identity = 63/84 (75.00%), Postives = 74/84 (88.10%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M TV++IR AQRA+GPATV+AIGTATP +  +Q+ YPDYYFRIT SEH  ELKEKF+RMCDKSMIKKR+M+LTEEILKENP +C
Sbjct:    1 MVTVEDIRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKKRYMYLTEEILKENPQVC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS7_PICMA (Chalcone synthase 7 OS=Picea mariana GN=CSF7 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.480e-32
Identity = 62/84 (73.81%), Postives = 75/84 (89.29%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            MA ++  R AQRADGPAT+LAIGTATP ++ +Q+ YPDYYF+IT SEHMTELKEKF+RMCDKS IKKR+M+LT+EILKENPN+C
Sbjct:    6 MADLEAFRKAQRADGPATILAIGTATPPNAVDQSTYPDYYFKITNSEHMTELKEKFQRMCDKSAIKKRYMYLTDEILKENPNVC 89          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: THS5_VITVI (Stilbene synthase 5 OS=Vitis vinifera GN=GSVIVT00007357001 PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 4.545e-32
Identity = 62/83 (74.70%), Postives = 76/83 (91.57%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNM 294
            MA+V+EIRNAQRA GPAT+LAIGTATP H   Q+DY DYYF++TKSEHMTELK+KF R+CDKSMIKKR++HLTEE+L+E+PN+
Sbjct:    1 MASVEEIRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFKVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNI 83          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSY_PERFR (Chalcone synthase OS=Perilla frutescens GN=CHS PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 4.545e-32
Identity = 62/83 (74.70%), Postives = 74/83 (89.16%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNM 294
            M TV++IR AQRA+GPATV+AIGTATP +  +Q+ YPDYYFRIT SEH T+LKEKF+RMC+KSMI+KR+MHLTEE LKENPNM
Sbjct:    1 MVTVEDIRRAQRAEGPATVMAIGTATPENCVDQSTYPDYYFRITNSEHRTDLKEKFKRMCEKSMIRKRYMHLTEEFLKENPNM 83          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSY_HYPAN (Chalcone synthase OS=Hypericum androsaemum PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 4.545e-32
Identity = 62/84 (73.81%), Postives = 72/84 (85.71%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M TV+E+R AQRA+GPATV+AIGTA P +  +QA YPDYYFRIT SEH  ELKEKF+RMCDKS IKKR+M+L EE+LKENPNMC
Sbjct:    1 MVTVEEVRKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKKRYMYLNEEVLKENPNMC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS7_SOYBN (Chalcone synthase 7 OS=Glycine max GN=CHS7 PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 4.545e-32
Identity = 63/84 (75.00%), Postives = 73/84 (86.90%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M +V EIR AQRA+GPAT+LAIGTA P +  +Q+ YPDYYFRIT S+HMTELKEKF+RMCDKSMIK R+M+L EEILKENPNMC
Sbjct:    1 MVSVAEIRQAQRAEGPATILAIGTANPPNRVDQSTYPDYYFRITNSDHMTELKEKFQRMCDKSMIKTRYMYLNEEILKENPNMC 84          
The following BLAST results are available for this feature:
BLAST of FC876316 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 140
Match NameE-valueIdentityDescription
CHS1_SINAL9.158e-3375.90Chalcone synthase 1 OS=Sinapis alba GN=CHS1 PE=2 S... [more]
CHSA_PEA1.196e-3276.19Chalcone synthase 1A OS=Pisum sativum GN=CHS-1A PE... [more]
CHSY_CARAN1.562e-3276.83Chalcone synthase OS=Cardamine amara GN=CHS PE=3 S... [more]
CHSE_IPONI2.040e-3272.62Chalcone synthase E OS=Ipomoea nil GN=CHSE PE=2 SV... [more]
CHS1_CAMSI2.665e-3275.00Chalcone synthase 1 OS=Camellia sinensis GN=CHS1 P... [more]
CHS7_PICMA3.480e-3273.81Chalcone synthase 7 OS=Picea mariana GN=CSF7 PE=2 ... [more]
THS5_VITVI4.545e-3274.70Stilbene synthase 5 OS=Vitis vinifera GN=GSVIVT000... [more]
CHSY_PERFR4.545e-3274.70Chalcone synthase OS=Perilla frutescens GN=CHS PE=... [more]
CHSY_HYPAN4.545e-3273.81Chalcone synthase OS=Hypericum androsaemum PE=1 SV... [more]
CHS7_SOYBN4.545e-3275.00Chalcone synthase 7 OS=Glycine max GN=CHS7 PE=3 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003C08EF DevOvary1 Citrus clementina cDNA clone C32003C08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876316 ID=FC876316|Name=FC876316|organism=Citrus clementina|type=EST|length=298bp
ACCAAGCACGAGCCACCCACATATTCATTAAGGGTTCAACTTGAAATGGC
AACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGCCACCG
TCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGCCAACCAGGCTGAT
TATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACGGAGCT
TAAAGAGAAGTTCAGGCGCATGTGTGACAAGTCGATGATTAAGAAGCGCC
ACATGCACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGTGCG
back to top