FC876320

Overview
NameFC876320
Unique NameFC876320
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length514
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:2..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876320 vs. ExPASy Swiss-Prot
Match: G3P_YARLI (Glyceraldehyde-3-phosphate dehydrogenase OS=Yarrowia lipolytica GN=GPD PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 9.486e-38
Identity = 80/143 (55.94%), Postives = 100/143 (69.93%), Query Frame = 2
Query:   86 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 514
            +K+GINGFGRIGR+V R  L+  +VE+VAVNDPFI T+Y  YMFKYDS HG++K  +++ KD   ++ G K + VFG R+P  IPW + GA+YVVESTGVFT               VIISAPS DAPMFVVGVN   YKP++
Sbjct:    3 IKVGINGFGRIGRIVLRNALKNPEVEVVAVNDPFIDTEYAAYMFKYDSTHGRFKG-KVEAKDGGLIIDG-KHIQVFGERDPSNIPWGKAGADYVVESTGVFTGKEAASAHLKGGAKKVIISAPSGDAPMFVVGVNLDAYKPDM 143          
BLAST of FC876320 vs. ExPASy Swiss-Prot
Match: G3P_PONAB (Glyceraldehyde-3-phosphate dehydrogenase OS=Pongo abelii GN=GAPDH PE=2 SV=3)

HSP 1 Score: 154.066 bits (388), Expect = 3.605e-37
Identity = 78/146 (53.42%), Postives = 98/146 (67.12%), Query Frame = 2
Query:   77 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 514
            MGKVK+GINGFGRIGRLV R       V++VA+NDPFI  +YM YMF+YDS HG++ H  +K ++ K ++ G  P+T+F  R+P +I W + GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    1 MGKVKVGINGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKF-HGTVKAENGKLVING-NPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSL 144          
BLAST of FC876320 vs. ExPASy Swiss-Prot
Match: G3P_HUMAN (Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens GN=GAPDH PE=1 SV=3)

HSP 1 Score: 153.68 bits (387), Expect = 4.708e-37
Identity = 77/146 (52.74%), Postives = 98/146 (67.12%), Query Frame = 2
Query:   77 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 514
            MGKVK+G+NGFGRIGRLV R       V++VA+NDPFI  +YM YMF+YDS HG++ H  +K ++ K ++ G  P+T+F  R+P +I W + GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y   L
Sbjct:    1 MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKF-HGTVKAENGKLVING-NPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSL 144          
BLAST of FC876320 vs. ExPASy Swiss-Prot
Match: G3P_PICAN (Glyceraldehyde-3-phosphate dehydrogenase OS=Pichia angusta GN=GPD PE=3 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 8.030e-37
Identity = 74/141 (52.48%), Postives = 93/141 (65.96%), Query Frame = 2
Query:   92 IGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 514
            +GINGFGRIGRLV R+ L RDD+ ++A+NDPFI  DY  YMFKYDS HG++K       + K L+   K + VF  R+P  IPW + G +YV++STGVFT               VII+APSKDAPMFVVGVN  EY P++
Sbjct:    5 VGINGFGRIGRLVLRIALSRDDINVIAINDPFIAPDYAAYMFKYDSTHGKFK--GTVTHEGKYLVINGKKIEVFQERDPANIPWGKEGVDYVLDSTGVFTTIEGAQKHIDAGAKKVIITAPSKDAPMFVVGVNHEEYTPDI 143          
BLAST of FC876320 vs. ExPASy Swiss-Prot
Match: G3P_ERYGR (Glyceraldehyde-3-phosphate dehydrogenase OS=Erysiphe graminis subsp. hordei GN=GPD PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.049e-36
Identity = 80/146 (54.79%), Postives = 94/146 (64.38%), Query Frame = 2
Query:   77 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 514
            M  +K+GINGFGRIGR+V R   Q  +VE+VAVNDPFI  +Y  YM KYDS HGQ+      V+D   L+   + V  +  RNPEEIPWAETGAEY+VESTGVFT               VIISAPS DAPMFV+GVN   Y  +L
Sbjct:    1 MAPIKVGINGFGRIGRIVFRNAAQSCEVEVVAVNDPFIEPEYAAYMLKYDSTHGQFNGDIQTVEDG--LVVNSRNVKFYNKRNPEEIPWAETGAEYIVESTGVFTTTEKAKAHLKGGAKKVIISAPSADAPMFVMGVNHKSYTTDL 144          
BLAST of FC876320 vs. ExPASy Swiss-Prot
Match: G3P_SCHCO (Glyceraldehyde-3-phosphate dehydrogenase OS=Schizophyllum commune GN=GPD PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 1.789e-36
Identity = 77/139 (55.40%), Postives = 97/139 (69.78%), Query Frame = 2
Query:   86 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 502
            VK+GINGFGRIGR+V R  LQ  ++E+VA+NDPFI  DYM YMFKYD+VHG++K   ++VKD K ++ G   +TVF  +NP +I W   GA+Y+VESTGVFT               V+ISAPS DAPMFVVGVN  +Y
Sbjct:    3 VKVGINGFGRIGRIVLRNALQLGNIEVVAINDPFIALDYMVYMFKYDTVHGRYK-GTVEVKDGKLVVDGH-AITVFAEKNPADIKWGSAGADYIVESTGVFTTVEKASLHLQGGAKKVVISAPSADAPMFVVGVNLDKY 139          
BLAST of FC876320 vs. ExPASy Swiss-Prot
Match: G3P_ONCVO (Glyceraldehyde 3-phosphate-dehydrogenase OS=Onchocerca volvulus PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 2.336e-36
Identity = 80/145 (55.17%), Postives = 95/145 (65.52%), Query Frame = 2
Query:   77 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEK---PVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEY 502
            M K KIGINGFGRIGRLV R  +++D VE+VAVNDPFI  DYM YMFKYDS HG++K H +  +  K ++   K    + V   ++P EIPW   GAEYVVESTGVFT               VIISAPS DAPMFV+GVN  +Y
Sbjct:    1 MSKPKIGINGFGRIGRLVLRAAVEKDTVEVVAVNDPFINIDYMVYMFKYDSTHGRFKGH-VSAEGGKLIVTNGKTTHQIAVHNSKDPAEIPWGVEGAEYVVESTGVFTHTEKASAHLKGGAKKVIISAPSADAPMFVMGVNNDKY 144          
BLAST of FC876320 vs. ExPASy Swiss-Prot
Match: G3PC_CHOCR (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Chondrus crispus GN=GAPC PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 3.051e-36
Identity = 75/142 (52.82%), Postives = 96/142 (67.61%), Query Frame = 2
Query:   89 KIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 514
            K+GINGFGRIGRLV R  +++   ++VA+NDPFI  DYM YM KYDS HG++   ++ +KD K  + G   +TVF  R+P EIPWA   A+Y+VE+TGVFT               V+ISAPSKDAPMFV GVNE +Y P+L
Sbjct:    5 KVGINGFGRIGRLVLRAAIEKGTCQVVAINDPFIDLDYMAYMLKYDSTHGRYAG-DVSIKDGKLQVDGNS-ITVFAHRDPAEIPWATAAADYIVEATGVFTLKDKAAAHFKGGAKKVVISAPSKDAPMFVCGVNEAKYTPDL 144          
BLAST of FC876320 vs. ExPASy Swiss-Prot
Match: G3P2_AGABI (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Agaricus bisporus GN=gpd2 PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 3.051e-36
Identity = 78/142 (54.93%), Postives = 98/142 (69.01%), Query Frame = 2
Query:   86 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 511
            VK+GINGFGRIGR+V R  LQ  D+E+VAVNDPFI  +YM YMFKYDSVHG++K   ++VK+   ++ G +P+ VF  R+P  IPW   GA+YVVESTGVFT               V+ISAPS DAPM+V GVN  +Y P+
Sbjct:    2 VKVGINGFGRIGRIVLRNALQFQDIEVVAVNDPFIDLEYMAYMFKYDSVHGRFK-GTVEVKNGSFVVDG-RPMKVFAERDPAAIPWGSVGADYVVESTGVFTTIDKASAHLKGGAKKVVISAPSADAPMYVCGVNLDKYNPK 141          
BLAST of FC876320 vs. ExPASy Swiss-Prot
Match: G3P_PARBA (Glyceraldehyde-3-phosphate dehydrogenase OS=Paracoccidioides brasiliensis (strain ATCC MYA-826 / Pb01) GN=GPD PE=1 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 5.205e-36
Identity = 75/143 (52.45%), Postives = 93/143 (65.03%), Query Frame = 2
Query:   86 VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 514
            VK+GINGFGRIGR+V R  ++ DDVE+VAVNDPFI T Y  YM KYDS HGQ+K  +++      L    K +  +  R+P  IPW + G +YVVESTGVFT               VIISAPS DAPMFV+GVNE  Y+P++
Sbjct:    3 VKVGINGFGRIGRIVFRNAVEHDDVEIVAVNDPFIETKYAAYMLKYDSTHGQFK-GDIQHSSSNNLTVNNKTIHFYQERDPANIPWGKHGVDYVVESTGVFTTTEKAKAHLSGGAKKVIISAPSADAPMFVMGVNEKSYRPDI 144          
The following BLAST results are available for this feature:
BLAST of FC876320 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 308
Match NameE-valueIdentityDescription
G3P_YARLI9.486e-3855.94Glyceraldehyde-3-phosphate dehydrogenase OS=Yarrow... [more]
G3P_PONAB3.605e-3753.42Glyceraldehyde-3-phosphate dehydrogenase OS=Pongo ... [more]
G3P_HUMAN4.708e-3752.74Glyceraldehyde-3-phosphate dehydrogenase OS=Homo s... [more]
G3P_PICAN8.030e-3752.48Glyceraldehyde-3-phosphate dehydrogenase OS=Pichia... [more]
G3P_ERYGR1.049e-3654.79Glyceraldehyde-3-phosphate dehydrogenase OS=Erysip... [more]
G3P_SCHCO1.789e-3655.40Glyceraldehyde-3-phosphate dehydrogenase OS=Schizo... [more]
G3P_ONCVO2.336e-3655.17Glyceraldehyde 3-phosphate-dehydrogenase OS=Onchoc... [more]
G3PC_CHOCR3.051e-3652.82Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3P2_AGABI3.051e-3654.93Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Agar... [more]
G3P_PARBA5.205e-3652.45Glyceraldehyde-3-phosphate dehydrogenase OS=Paraco... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D02EF DevOvary1 Citrus clementina cDNA clone C32003D02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876320 ID=FC876320|Name=FC876320|organism=Citrus clementina|type=EST|length=514bp
GACCACGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCA
CCGCTCAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATC
AACGGATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAG
GGACGATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATT
ACATGACATACATGTTTAAGTACGACAGTGTTCACGGTCAATGGAAGCAC
CATGAATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCC
TGTCACTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGA
CTGGAGCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGAT
AAGGCTGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGC
CCCCAGCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGT
ACAAACCAGAGCTC
back to top