FC876326

Overview
NameFC876326
Unique NameFC876326
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length696
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15191 contig Ccv1_Contig15191:2..697. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH3_ARATH (Cinnamyl alcohol dehydrogenase 3 OS=Arabidopsis thaliana GN=CAD3 PE=1 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 4.090e-66
Identity = 112/170 (65.88%), Postives = 134/170 (78.82%), Query Frame = 1
Query:  115 AFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDK 624
            AFGWAA D SGVLSPFHFSRR  GE DVT K+  CG+CHSDLH IKN WG + YPI+PGHEIVG+ T+VG  V+KFK GD+VGVG ++GSC+SC+SC  DLENYCPKV+ TY S+  DGT   GGYSD +V D  FV+ IP+G P D+ APLLCAGITVYS +++YG+ K
Sbjct:    7 AFGWAANDESGVLSPFHFSRRENGENDVTVKILFCGVCHSDLHTIKNHWGFSRYPIIPGHEIVGIATKVGKNVTKFKEGDRVGVGVIIGSCQSCESCNQDLENYCPKVVFTYNSRSSDGTRNQGGYSDVIVVDHRFVLSIPDGLPSDSGAPLLCAGITVYSPMKYYGMTK 176          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: MTDH_PETCR (Mannitol dehydrogenase (Fragment) OS=Petroselinum crispum GN=ELI3 PE=2 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 5.342e-66
Identity = 115/161 (71.43%), Postives = 133/161 (82.61%), Query Frame = 1
Query:  148 VLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            +LSPF FSRRATG+ DV FKV +CG+CHSDLH++KNEWG   YPIVPGHEIVG VTEVGSKV KFKVGD VGVGC+VGSC SC++C  D EN C K + TYA    DG+ITYGGY+D+MVAD+HFV+R PE  PLD+ APLLCAGIT YS LR++GLDKPG
Sbjct:    1 ILSPFKFSRRATGDNDVRFKVLYCGVCHSDLHMVKNEWGMTTYPIVPGHEIVGRVTEVGSKVEKFKVGDAVGVGCLVGSCLSCENCDDDSENNCAKQVQTYAFTNVDGSITYGGYADSMVADQHFVLRWPENLPLDSGAPLLCAGITTYSPLRYHGLDKPG 161          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CAD8B_ORYSJ (Probable cinnamyl alcohol dehydrogenase 8B OS=Oryza sativa subsp. japonica GN=CAD8B PE=3 SV=2)

HSP 1 Score: 250.366 bits (638), Expect = 6.977e-66
Identity = 112/178 (62.92%), Postives = 140/178 (78.65%), Query Frame = 1
Query:   97 QEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            +EH K A GWAARD SGVLSP++FSRRA  + DVT KV +CGICH+DLH++KN+WGNA+YP+VPGHEIVGVVT VG+ V+KFK GD VGVG  VGSCR+CDSC    ENYCP +++T   K + G  T GG+SD +V +EH+V+R+P G PLD  APLLCAG+TVYS +  +GL+ PG
Sbjct:   77 EEHGKAAVGWAARDDSGVLSPYNFSRRAQKDDDVTIKVLYCGICHTDLHVVKNDWGNAMYPVVPGHEIVGVVTGVGAGVTKFKAGDTVGVGFFVGSCRTCDSCGKGYENYCPTMVITSNGKDYGGAATQGGFSDAIVVNEHYVLRVPAGLPLDGAAPLLCAGVTVYSPMVIHGLNAPG 254          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH2_ARATH (Cinnamyl alcohol dehydrogenase 2 OS=Arabidopsis thaliana GN=CAD2 PE=1 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 7.713e-65
Identity = 112/171 (65.50%), Postives = 134/171 (78.36%), Query Frame = 1
Query:  115 AFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTI-TYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDK 624
            AFGWAA D SGVLSPFHFSRR  GE DVT K+  CG+CHSDLH IKN WG + YPI+PGHEIVG+ T+VG  V+KFK GD+VGVG ++GSC+SC+SC  DLENYCPKV+ TY S+  DGT    GGYSD +V D  FV+ IP+G P D+ APLLCAGITVYS +++YG+ K
Sbjct:    7 AFGWAANDESGVLSPFHFSRRENGENDVTVKILFCGVCHSDLHTIKNHWGFSRYPIIPGHEIVGIATKVGKNVTKFKEGDRVGVGVIIGSCQSCESCNQDLENYCPKVVFTYNSRSSDGTSRNQGGYSDVIVVDHRFVLSIPDGLPSDSGAPLLCAGITVYSPMKYYGMTK 177          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH5_ORYSJ (Putative cinnamyl alcohol dehydrogenase 5 OS=Oryza sativa subsp. japonica GN=CAD5 PE=3 SV=2)

HSP 1 Score: 243.047 bits (619), Expect = 1.114e-63
Identity = 116/174 (66.67%), Postives = 130/174 (74.71%), Query Frame = 1
Query:  106 PKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKP 627
            P  A G AARD SG LSP   SRR+TG+ DV  K+ +CGICHSDLH IKNEW NA YP+VPGHEI GVVTE G  V+KFK GDKVGVGCMV SC SCDSC   LEN+CP VI TY S   DGT+TYGGYS  +V  E FVVR PE  PLD  APLLCAGITVYS ++++GL+ P
Sbjct:    3 PTAAAGLAARDASGHLSPLTISRRSTGDDDVVIKILYCGICHSDLHSIKNEWKNATYPLVPGHEIAGVVTEAGKNVTKFKGGDKVGVGCMVNSCHSCDSCNQGLENHCPGVIFTYNSVDKDGTVTYGGYSSMVVVHERFVVRFPEAMPLDKGAPLLCAGITVYSPMKYHGLNVP 176          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CAD8C_ORYSJ (Probable cinnamyl alcohol dehydrogenase 8C OS=Oryza sativa subsp. japonica GN=CAD8C PE=2 SV=2)

HSP 1 Score: 240.35 bits (612), Expect = 7.220e-63
Identity = 110/181 (60.77%), Postives = 137/181 (75.69%), Query Frame = 1
Query:   97 QEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHD---GTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            +EH K A GWAARD SGVLSP++FSRRA  + DVT KV +CGICH+DLH++KN+WGNA+YP+VPGHEIVGVVT VG+ V+KFK GD VGVG  V SCR C+ C    ENYC K++ T     HD   G  T GG+SD +V +EH+V+R+P G PLD+ APLLCAG+TVYS +  +GL+ PG
Sbjct:   77 EEHGKAAVGWAARDDSGVLSPYNFSRRAQKDDDVTIKVLYCGICHTDLHIVKNDWGNAMYPVVPGHEIVGVVTGVGAGVTKFKAGDTVGVGYFVASCRGCECCGNGYENYCAKMVTTCNGVDHDHGGGAATQGGFSDAIVVNEHYVLRVPAGLPLDSAAPLLCAGVTVYSPMVIHGLNAPG 257          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH3_ORYSJ (Probable cinnamyl alcohol dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CAD3 PE=2 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 9.429e-63
Identity = 110/174 (63.22%), Postives = 133/174 (76.44%), Query Frame = 1
Query:  109 KNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            + A G AARD+SG LSPF  SRR+TG+ DV  K+  CGICHSDLH IKNEW ++IYP+VPGHEI GVVTEVG  V++FK GD+VGVGCMV SCRSC+SC    EN+CP+ + TY S   DGT+TYGGYS  +V  E FVV  PE  PLD  APLLCAGITVY+ ++++GL+ PG
Sbjct:   14 QQAVGLAARDSSGHLSPFAISRRSTGDDDVAIKILFCGICHSDLHCIKNEWKHSIYPLVPGHEIAGVVTEVGKNVTRFKAGDRVGVGCMVNSCRSCESCNNGFENHCPEGVFTYNSVDKDGTVTYGGYSSMVVVHERFVVMFPEAMPLDVGAPLLCAGITVYTPMKYHGLNAPG 187          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: MTDH1_STYHU (Probable mannitol dehydrogenase 1 OS=Stylosanthes humilis GN=CAD1 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.322e-61
Identity = 105/172 (61.05%), Postives = 132/172 (76.74%), Query Frame = 1
Query:  115 AFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            AFGWAA+D SG LSPFHF+RR     DVT K+ +CG+CHSDLH +KN+WG   YP+VPGHEI G+VT+VGS V+KFK GD+VGVG +V SC+ C+ C  DLE+YCPK + TY S Y  GT T GGYSD +V  + FV++ P+  PLDA APLLCAGITVYS +++YG+ +PG
Sbjct:    6 AFGWAAKDASGHLSPFHFTRRQNEADDVTLKILYCGVCHSDLHTVKNDWGFTTYPVVPGHEIAGIVTKVGSNVTKFKEGDRVGVGVIVDSCQECECCQQDLESYCPKPVFTYNSPY-KGTRTQGGYSDFVVVHQRFVLQFPDNLPLDAGAPLLCAGITVYSPMKYYGMTEPG 176          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CAD8D_ORYSJ (Probable cinnamyl alcohol dehydrogenase 8D OS=Oryza sativa subsp. japonica GN=CAD8D PE=2 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 1.966e-60
Identity = 108/172 (62.79%), Postives = 128/172 (74.42%), Query Frame = 1
Query:  115 AFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            A GWAARDTSG LSPF F+RR   E DVT KV +CGICH+DLH+IKNEWGNA+YP+VPGHEIVGVVT VG+ V+KFK GD VGVG  V SCR+CDSC    ENYCP +++T     + G  T GG+SD MV  + +VVR+P   P D  APLLCAG+TVYS +  YGL+ PG
Sbjct:    8 ALGWAARDTSGHLSPFSFTRRVQQEDDVTIKVLYCGICHTDLHIIKNEWGNAMYPVVPGHEIVGVVTGVGAGVTKFKAGDTVGVGYFVDSCRACDSCGKGYENYCPTMVITSNGTDYGGATTQGGFSDVMVVRQDYVVRVPASLPPDGAAPLLCAGVTVYSPMVEYGLNGPG 179          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH7_ORYSJ (Cinnamyl alcohol dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CAD7 PE=2 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 4.100e-58
Identity = 110/191 (57.59%), Postives = 131/191 (68.59%), Query Frame = 1
Query:   85 QAPEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCP-KVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGA--------PLDATAPLLCAGITVYSLLRFYGLDKPG 630
            QAP  +H + A G AA D SG L+P   SRR TG+ DV  KV +CGICHSDLH IKNEW NA+YP+V GHEI GVVTEVG  V++FK GD+VGVGCMV +C  C+SC    ENYC   V+ TY S   DGT TYGGYSD +V  + FVVR P  A        PLD+ APLLCAG+TVY+ +R +GL + G
Sbjct:   13 QAPPPQHTRKAVGLAAHDDSGHLTPIRISRRKTGDDDVAIKVLYCGICHSDLHTIKNEWRNAVYPVVAGHEITGVVTEVGKNVARFKAGDEVGVGCMVNTCGGCESCRDGCENYCSGGVVFTYNSVDRDGTRTYGGYSDAVVVSQRFVVRFPSSAGGGAGAALPLDSGAPLLCAGVTVYAPMRQHGLCEAG 203          
The following BLAST results are available for this feature:
BLAST of FC876326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
CADH3_ARATH4.090e-6665.88Cinnamyl alcohol dehydrogenase 3 OS=Arabidopsis th... [more]
MTDH_PETCR5.342e-6671.43Mannitol dehydrogenase (Fragment) OS=Petroselinum ... [more]
CAD8B_ORYSJ6.977e-6662.92Probable cinnamyl alcohol dehydrogenase 8B OS=Oryz... [more]
CADH2_ARATH7.713e-6565.50Cinnamyl alcohol dehydrogenase 2 OS=Arabidopsis th... [more]
CADH5_ORYSJ1.114e-6366.67Putative cinnamyl alcohol dehydrogenase 5 OS=Oryza... [more]
CAD8C_ORYSJ7.220e-6360.77Probable cinnamyl alcohol dehydrogenase 8C OS=Oryz... [more]
CADH3_ORYSJ9.429e-6363.22Probable cinnamyl alcohol dehydrogenase 3 OS=Oryza... [more]
MTDH1_STYHU2.322e-6161.05Probable mannitol dehydrogenase 1 OS=Stylosanthes ... [more]
CAD8D_ORYSJ1.966e-6062.79Probable cinnamyl alcohol dehydrogenase 8D OS=Oryz... [more]
CADH7_ORYSJ4.100e-5857.59Cinnamyl alcohol dehydrogenase 7 OS=Oryza sativa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D08EF DevOvary1 Citrus clementina cDNA clone C32003D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876326 ID=FC876326|Name=FC876326|organism=Citrus clementina|type=EST|length=696bp
GATTGCACCTTGTTTATTCAAATACCCTGGACGTCAAACTAAGCCAACAA
GCACCAATATCATTAAATTCATTCTGAAATGGGGCAAGCACCGGAGCAAG
AGCACCCTAAGAACGCCTTTGGATGGGCTGCCAGGGACACTTCTGGCGTT
CTCTCCCCCTTTCACTTCTCCAGAAGAGCAACGGGAGAGAAGGATGTGAC
ATTCAAAGTAACTCACTGTGGGATATGCCATTCAGATCTTCACTTGATCA
AAAATGAATGGGGCAATGCCATTTACCCAATCGTCCCCGGACATGAGATT
GTGGGCGTAGTGACAGAGGTCGGAAGCAAAGTGAGTAAATTCAAAGTCGG
AGACAAAGTGGGAGTAGGATGCATGGTGGGATCATGCCGCTCTTGTGATA
GCTGCGCCATTGATCTTGAGAACTACTGCCCCAAAGTTATAATGACCTAT
GCCAGCAAGTACCATGATGGAACCATCACATACGGAGGCTACTCTGACAC
TATGGTTGCCGATGAGCACTTTGTGGTCCGTATTCCTGAAGGCGCACCAC
TTGACGCCACTGCCCCTCTCCTCTGTGCTGGTATCACAGTCTACAGTCTG
TTGAGATTCTATGGACTCGACAAGCCTGGTATGCATGTGGGTGTTGTCGG
CTTGGGCGGTCTAGGCCATGTCGCTGTCAAATCGCAAGGCTATGGG
back to top