FC876326

Overview
NameFC876326
Unique NameFC876326
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length696
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15191 contig Ccv1_Contig15191:2..697. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADHX_DROME (Alcohol dehydrogenase class-3 OS=Drosophila melanogaster GN=Fdh PE=1 SV=3)

HSP 1 Score: 69.3218 bits (168), Expect = 2.204e-11
Identity = 46/151 (30.46%), Postives = 67/151 (44.37%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASK-----------------YHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVY 594
            +V  K+T  G+CH+D   +       ++P+V GHE  G+V  VG  V+ FK GD V +   +  C  C  C     N C K+ +T  +                  +  GT T+  Y  T+VAD   + +I E APL+    L C   T Y
Sbjct:   37 EVRIKITATGVCHTDAFTLSGADPEGLFPVVLGHEGAGIVESVGEGVTNFKAGDHV-IALYIPQCNECKFCKSGKTNLCQKIRLTQGAGVMPEGTSRLSCKGQQLFHFMGTSTFAEY--TVVADIS-LTKINEKAPLEKVCLLGCGISTGY 183          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH4_STRCA (Alcohol dehydrogenase 4 OS=Struthio camelus GN=ADH4 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.204e-11
Identity = 46/154 (29.87%), Postives = 67/154 (43.51%), Query Frame = 1
Query:  187 EKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKV--IMTYASKYH---DGTITY-------------GGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVY 594
            + +V  K+   G+C +D H I   +   ++P++ GHE  G+V  +G  VSKFK GDKV +   +  C  C  C     N C K+  I T  S      DGT  +               +S+  V  E  + +I   APLD    + C   T Y
Sbjct:   33 DHEVRVKIVATGVCRTDEHAINPSFKEGVFPVILGHEGAGIVESIGQGVSKFKPGDKV-IPLYMPQCGHCKFCLNPKTNLCEKISKIKTPISDQEVMSDGTSRFTCKGKPIYHFMGTSTFSEYTVVSESSLAKIDAAAPLDKVCLIGCGFSTGY 185          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH1B_UROHA (Alcohol dehydrogenase 1B OS=Uromastyx hardwickii PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 2.879e-11
Identity = 49/148 (33.11%), Postives = 68/148 (45.95%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPK-VIMTYASKYHDGT--ITY-----------GGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVY 594
            +V  K+   GIC SD H++        +PI+ GHE  GVV  VG  V+  K GDKV +   +  C  C+SC     N C K  +  +    +DGT   TY           G +++  VA E  VV+I   APL+    + C   T Y
Sbjct:   35 EVRIKILASGICRSDDHVLSGAL-KVNFPIILGHEAAGVVESVGEGVTSMKPGDKV-IPIFLPQCGECNSCRHPRGNVCKKSELGPFTGLLYDGTSRFTYQGKPVYHFVRTGTFTEYTVAPEDSVVKIDASAPLEKVCLIGCGFSTGY 180          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADHL_GADMO (Alcohol dehydrogenase class-3 chain L OS=Gadus morhua PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.760e-11
Identity = 46/148 (31.08%), Postives = 68/148 (45.95%), Query Frame = 1
Query:  193 DVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTY--------ASKYH-DGTITY-----GGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVY 594
            +V  K+   GICH+D + +       ++P V GHE  G+V  VG  V+KFK GD V +   V  C  C  C     N C K+ +T          S++  +G + +       +S+  V  E  + ++ E APLD    L CA  T Y
Sbjct:   35 EVRIKIVATGICHTDAYTLSGSDPEGVFPSVLGHEGAGIVESVGEGVTKFKSGDAV-IPLYVPQCGECKFCKNPKTNLCQKIRLTQGKGLMPNGTSRFSCNGQVLFHFMGSSTFSEYTVVAEISLAKVHEKAPLDKVCLLGCAISTGY 181          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH7_MOUSE (Alcohol dehydrogenase class 4 mu/sigma chain OS=Mus musculus GN=Adh7 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.760e-11
Identity = 44/148 (29.73%), Postives = 68/148 (45.95%), Query Frame = 1
Query:  190 KDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITY-------------GGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVY 594
            K+V  K+   GIC +D H+IK    +  +P++ GHE VGVV  VG  V+  + GDKV +   +  CR C++C     N C +  +T      DGT  +               +++  V DE  V ++   AP +    + C   T Y
Sbjct:   35 KEVRVKILATGICRTDDHIIKGSMVSK-FPVIVGHEAVGVVESVGEGVTTVRPGDKV-IPLFLPQCRECNACLNPEGNLCIRSDLTGCGVLADGTTRFTCKGKPVQHFMNTSTFTEYTVLDESSVAKVDGAAPPEKACLIGCGFSTGY 180          
The following BLAST results are available for this feature:
BLAST of FC876326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
ADHX_DROME2.204e-1130.46Alcohol dehydrogenase class-3 OS=Drosophila melano... [more]
ADH4_STRCA2.204e-1129.87Alcohol dehydrogenase 4 OS=Struthio camelus GN=ADH... [more]
ADH1B_UROHA2.879e-1133.11Alcohol dehydrogenase 1B OS=Uromastyx hardwickii P... [more]
ADHL_GADMO3.760e-1131.08Alcohol dehydrogenase class-3 chain L OS=Gadus mor... [more]
ADH7_MOUSE3.760e-1129.73Alcohol dehydrogenase class 4 mu/sigma chain OS=Mu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D08EF DevOvary1 Citrus clementina cDNA clone C32003D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876326 ID=FC876326|Name=FC876326|organism=Citrus clementina|type=EST|length=696bp
GATTGCACCTTGTTTATTCAAATACCCTGGACGTCAAACTAAGCCAACAA
GCACCAATATCATTAAATTCATTCTGAAATGGGGCAAGCACCGGAGCAAG
AGCACCCTAAGAACGCCTTTGGATGGGCTGCCAGGGACACTTCTGGCGTT
CTCTCCCCCTTTCACTTCTCCAGAAGAGCAACGGGAGAGAAGGATGTGAC
ATTCAAAGTAACTCACTGTGGGATATGCCATTCAGATCTTCACTTGATCA
AAAATGAATGGGGCAATGCCATTTACCCAATCGTCCCCGGACATGAGATT
GTGGGCGTAGTGACAGAGGTCGGAAGCAAAGTGAGTAAATTCAAAGTCGG
AGACAAAGTGGGAGTAGGATGCATGGTGGGATCATGCCGCTCTTGTGATA
GCTGCGCCATTGATCTTGAGAACTACTGCCCCAAAGTTATAATGACCTAT
GCCAGCAAGTACCATGATGGAACCATCACATACGGAGGCTACTCTGACAC
TATGGTTGCCGATGAGCACTTTGTGGTCCGTATTCCTGAAGGCGCACCAC
TTGACGCCACTGCCCCTCTCCTCTGTGCTGGTATCACAGTCTACAGTCTG
TTGAGATTCTATGGACTCGACAAGCCTGGTATGCATGTGGGTGTTGTCGG
CTTGGGCGGTCTAGGCCATGTCGCTGTCAAATCGCAAGGCTATGGG
back to top