FC876326

Overview
NameFC876326
Unique NameFC876326
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length696
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15191 contig Ccv1_Contig15191:2..697. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH_STAES (Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=adh PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.058e-17
Identity = 42/142 (29.58%), Postives = 76/142 (53.52%), Query Frame = 1
Query:  205 KVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            K  +CG+CH+DLH+   ++G+ +  +  GHE +G V ++   V   KVGD+V +  M  +C +C+ C    E  C  V+       + G    G  ++ ++ D ++ V++PE     A + + CAG+T Y  ++  G++ PG
Sbjct:   30 KTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGRVIKIADNVDSLKVGDRVSIAWMYAACGNCEYCTTGRETLCRDVL-------NAGYTVDGAMAEEVIVDANYAVKVPENLDPAAASSITCAGVTTYKAVKVSGIE-PG 162          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH2_CAEEL (Alcohol dehydrogenase 2 OS=Caenorhabditis elegans GN=sodh-2 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.882e-16
Identity = 45/149 (30.20%), Postives = 77/149 (51.68%), Query Frame = 1
Query:  187 EKDVTFKVTHCGICHSDLHLIKNEWGNA-IYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            E ++  K+ + GICHSDLH  + ++  A I P++ GHE  G V  +GSKV  + +GD+ G+  +  +C +C+ C    E  C  +        + G   +G + + +   +   +++     L A AP+LC G+T Y  L+   + KPG
Sbjct:   34 ENELLVKIEYSGICHSDLHTWEGDFEYASICPLIGGHEGAGTVVTIGSKVKGWNIGDRAGIKLINANCLNCEYCKTGHEPLCDHI-------QNYGIDRHGTFQEYLTIRDIDAIKVSNDTNLAAAAPVLCGGVTAYKSLKATNV-KPG 174          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADHA_MYCTU (Probable alcohol dehydrogenase adhA OS=Mycobacterium tuberculosis GN=adhA PE=3 SV=3)

HSP 1 Score: 83.9593 bits (206), Expect = 8.648e-16
Identity = 52/136 (38.24%), Postives = 70/136 (51.47%), Query Frame = 1
Query:  217 CGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVS-----KFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVY-SLLR 606
            CG+C +DLH+ + +       ++PGHE+VG V EVGS V      +F  GD+VG+  +  +C  C  C    EN CP+      S+Y  G    GGY++       F   +P G      APLLCAGI  Y SLLR
Sbjct:   48 CGVCRTDLHVTEGDLPVHRERVIPGHEVVGEVIEVGSAVGAAAGGEFDRGDRVGIAWLRHTCGVCKYCRRGSENLCPQ------SRY-TGWDADGGYAEFTTVPAAFAHHLPSGYSDSELAPLLCAGIIGYRSLLR 176          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH_STAAW (Alcohol dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=adh PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.475e-15
Identity = 44/152 (28.95%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  175 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++   + KPG
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNV-KPG 162          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH_STAAS (Alcohol dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=adh PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.475e-15
Identity = 44/152 (28.95%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  175 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++   + KPG
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNV-KPG 162          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH_STAAR (Alcohol dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=adh PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.475e-15
Identity = 44/152 (28.95%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  175 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++   + KPG
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNV-KPG 162          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH_STAAN (Alcohol dehydrogenase OS=Staphylococcus aureus (strain N315) GN=adh PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.475e-15
Identity = 44/152 (28.95%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  175 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++   + KPG
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNV-KPG 162          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH_STAAM (Alcohol dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=adh PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.475e-15
Identity = 44/152 (28.95%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  175 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++   + KPG
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNV-KPG 162          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH_STAAC (Alcohol dehydrogenase OS=Staphylococcus aureus (strain COL) GN=adh PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.475e-15
Identity = 44/152 (28.95%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  175 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++   + KPG
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNV-KPG 162          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: ADH_STAAB (Alcohol dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=adh PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.475e-15
Identity = 44/152 (28.95%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  175 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++   + KPG
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNV-KPG 162          
The following BLAST results are available for this feature:
BLAST of FC876326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
ADH_STAES2.058e-1729.58Alcohol dehydrogenase OS=Staphylococcus epidermidi... [more]
ADH2_CAEEL3.882e-1630.20Alcohol dehydrogenase 2 OS=Caenorhabditis elegans ... [more]
ADHA_MYCTU8.648e-1638.24Probable alcohol dehydrogenase adhA OS=Mycobacteri... [more]
ADH_STAAW1.475e-1528.95Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]
ADH_STAAS1.475e-1528.95Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]
ADH_STAAR1.475e-1528.95Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]
ADH_STAAN1.475e-1528.95Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]
ADH_STAAM1.475e-1528.95Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]
ADH_STAAC1.475e-1528.95Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]
ADH_STAAB1.475e-1528.95Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D08EF DevOvary1 Citrus clementina cDNA clone C32003D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876326 ID=FC876326|Name=FC876326|organism=Citrus clementina|type=EST|length=696bp
GATTGCACCTTGTTTATTCAAATACCCTGGACGTCAAACTAAGCCAACAA
GCACCAATATCATTAAATTCATTCTGAAATGGGGCAAGCACCGGAGCAAG
AGCACCCTAAGAACGCCTTTGGATGGGCTGCCAGGGACACTTCTGGCGTT
CTCTCCCCCTTTCACTTCTCCAGAAGAGCAACGGGAGAGAAGGATGTGAC
ATTCAAAGTAACTCACTGTGGGATATGCCATTCAGATCTTCACTTGATCA
AAAATGAATGGGGCAATGCCATTTACCCAATCGTCCCCGGACATGAGATT
GTGGGCGTAGTGACAGAGGTCGGAAGCAAAGTGAGTAAATTCAAAGTCGG
AGACAAAGTGGGAGTAGGATGCATGGTGGGATCATGCCGCTCTTGTGATA
GCTGCGCCATTGATCTTGAGAACTACTGCCCCAAAGTTATAATGACCTAT
GCCAGCAAGTACCATGATGGAACCATCACATACGGAGGCTACTCTGACAC
TATGGTTGCCGATGAGCACTTTGTGGTCCGTATTCCTGAAGGCGCACCAC
TTGACGCCACTGCCCCTCTCCTCTGTGCTGGTATCACAGTCTACAGTCTG
TTGAGATTCTATGGACTCGACAAGCCTGGTATGCATGTGGGTGTTGTCGG
CTTGGGCGGTCTAGGCCATGTCGCTGTCAAATCGCAAGGCTATGGG
back to top