FC876328

Overview
NameFC876328
Unique NameFC876328
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length604
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10302 contig Ccv1_Contig10302:1..604. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C71DI_MENSP (Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.552e-17
Identity = 48/149 (32.21%), Postives = 80/149 (53.69%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHL-GPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGTEPVNLAXRLN--LCVV 599
            PP P   P++G+L  L G +P      +A+ +GP+ +++LG              Q +K+ D NF++R    G++ + Y+  DI+F PY   WR +R+I    L S K +  + ++RQEE+  L R L S+G  PV++   ++   CVV
Sbjct:   35 PPSPPKLPVIGHLHFLWGGLPQHVFRSIAQKYGPVAHVQLGEVYSVVLSSAEAAKQAMKVLDPNFADRFDGIGSRTMWYDKDDIIFSPYNDHWRQMRRICVTELLSPKNVRSFGYIRQEEIERLIRLLGSSGGAPVDVTEEVSKMSCVV 183          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C71DI_MENGR (Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.552e-17
Identity = 48/149 (32.21%), Postives = 80/149 (53.69%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHL-GPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGTEPVNLAXRLN--LCVV 599
            PP P   P++G+L  L G +P      +A+ +GP+ +++LG              Q +K+ D NF++R    G++ + Y+  DI+F PY   WR +R+I    L S K +  + ++RQEE+  L R L S+G  PV++   ++   CVV
Sbjct:   35 PPSPPKLPVIGHLHFLWGGLPQHVFRSIAQKYGPVAHVQLGEVYSVVLSSAEAAKQAMKVLDPNFADRFDGIGSRTMWYDKDDIIFSPYNDHWRQMRRICVTELLSPKNVRSFGYIRQEEIERLIRLLGSSGGAPVDVTEEVSKMSCVV 183          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C71AF_ARATH (Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.027e-17
Identity = 47/143 (32.87%), Postives = 73/143 (51.05%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRAL--ASAGTEPVNLAXRL 584
            PP P   P++GNL  L   PH+S+  L+  +GPLM L  G                +K HD   +NRP     + I    +++VF PYG  WR ++ +  VHL + K +  +  VR+EE +V+   +  AS+ + P+NL+  L
Sbjct:   33 PPSPWRVPVIGNLHQLSLHPHRSLRSLSHRYGPLMLLHFGRVPILVVSSSDVAHDLMKTHDLKVANRPRLKVIETILNGGREVVFSPYGDYWRQIKTVCVVHLLNKKMVQSFAKVREEERSVMMEKVEKASSDSSPLNLSKLL 175          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C71B3_ARATH (Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CYP71B3 PE=2 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 3.458e-17
Identity = 43/127 (33.86%), Postives = 70/127 (55.12%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRAL 542
            PP P   PI+GNL  L  + H+ +  L++ HGP++ LRLGF             + LK+HD     RP  + +   + + +DI F PYG   R LRK+S ++ FS + +  +R++R+EE  ++ + L
Sbjct:   30 PPSPPKLPIIGNLHQLRGLFHRCLHDLSKKHGPVLLLRLGFIDMVVISSKEAAEEVLKVHDLECCTRPKTNASSKFSRDGKDIAFAPYGEVSRELRKLSLINFFSTQKVRSFRYIREEENDLMVKKL 156          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C71AD_ARATH (Cytochrome P450 71A13 OS=Arabidopsis thaliana GN=CYP71A13 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.458e-17
Identity = 44/140 (31.43%), Postives = 72/140 (51.43%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRAL--ASAGTEPVNLA 575
            PP P   P++GNL  L   PH+S+  L+  +GPLM L  G              + LK HD  F+NRP +     +    +D+VF PYG  WR ++ +  ++L + K ++ +  VR++E+  +   L  AS+ +   NL+
Sbjct:   34 PPSPWRLPVIGNLHQLSLHPHRSLRSLSLRYGPLMLLHFGRVPILVVSSGEAAQEVLKTHDHKFANRPRSKAVHGLMNGGRDVVFAPYGEYWRQMKSVCILNLLTNKMVESFEKVREDEVNAMIEKLEKASSSSSSENLS 173          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C71D6_SOLCH (Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 5.899e-17
Identity = 49/144 (34.03%), Postives = 76/144 (52.78%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHL-GPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGT--EPVNLAXRL 584
            PPGP   P +G++ HL G  PH+ +  LA+ +GPLM+L+LG              + LK HD  F++RP       I Y+  DI F PYG  W+ +RKI    + S K++  +  +R +E+  L  ++ S+ +  E VN   R+
Sbjct:   32 PPGPWKLPFIGSMHHLAGGRPHRVLRDLAKKYGPLMHLQLGEVSAVVVTSPDMAKEVLKTHDIAFASRPKLLAMDIICYDRCDIAFSPYGEYWKQMRKICVTEVLSAKSVRSFSSIRCDEVVRLIDSIQSSSSSGELVNFKERV 175          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C98A1_SORBI (Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 7.704e-17
Identity = 40/136 (29.41%), Postives = 73/136 (53.68%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGTEPVN 569
            PPGP+PWP++GNL  + P+  +     A  +GP++ +  G              + LK +D   ++RP N   +  + N QD+++  YGP +  +RK+ ++ LF+ K L+  R +R++E+  +  ++  A T P N
Sbjct:   32 PPGPRPWPVLGNLRQIKPIRCRCFQEWAERYGPVISVWFGSGLTVVVSTSELAKEVLKENDQQLADRPRNRSTQRFSRNGQDLIWADYGPHYIKVRKLCNLELFTPKRLEALRPIREDEVTAMVESVYRAATAPGN 167          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C71BU_ARATH (Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 7.704e-17
Identity = 44/129 (34.11%), Postives = 66/129 (51.16%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALAS 548
            PPGP   P++GNL  LG + H S+  L+  HGP+M +R G              + LK HD    NRP         + Y+DI F  YG  WR ++K   + LFS K    +R++R+EE  +L + +++
Sbjct:   29 PPGPTGLPLIGNLHQLGRLLHSSLHKLSLEHGPVMLVRWGVVPMAVFSSNEAAKEVLKTHDLETCNRPKLVANGLFTHGYKDIGFTQYGEEWREMKKFVGLELFSPKKHKSFRYIREEEGDLLVKKISN 157          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C71BQ_ARATH (Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.006e-16
Identity = 45/139 (32.37%), Postives = 76/139 (54.68%), Query Frame = 3
Query:  165 PGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGT--EPVNLA 575
            P P  +PI+GNL  LG + HQS+  L++ +GP+M L+LG              Q L+ +D +  +RP  +G + ++YN  D+   PY   W+ LRK+ S  LFS   +   + ++ EE+  +  ++A + +   PVNL+
Sbjct:   33 PSPPGFPIIGNLHQLGELQHQSLWKLSKKYGPVMLLKLGKVPTLILSSSETAKQALRDYDLHCCSRPSLAGGRELSYNNLDMSSSPYNEYWKELRKLCSQELFSANKIQSIQPIKDEEVKKVIDSIAESSSLKNPVNLS 171          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C71BE_ARATH (Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.006e-16
Identity = 42/121 (34.71%), Postives = 65/121 (53.72%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMA 524
            PPGP   PI+GNL  LG  P +S+  L+  +G LM L+ G                LK  D+   +RP  +    + YN+ D+ F PY   WR +RK++ + L++ K +  +++VRQEE+A
Sbjct:   30 PPGPPRLPIIGNLHQLGSKPQRSLFKLSEKYGSLMSLKFGNVSAVVASTPETVKDVLKTFDAECCSRPYMTYPARVTYNFNDLAFSPYSKYWREVRKMTVIELYTAKRVKSFQNVRQEEVA 150          
The following BLAST results are available for this feature:
BLAST of FC876328 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 116
Match NameE-valueIdentityDescription
C71DI_MENSP1.552e-1732.21Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D1... [more]
C71DI_MENGR1.552e-1732.21Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D... [more]
C71AF_ARATH2.027e-1732.87Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=C... [more]
C71B3_ARATH3.458e-1733.86Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CY... [more]
C71AD_ARATH3.458e-1731.43Cytochrome P450 71A13 OS=Arabidopsis thaliana GN=C... [more]
C71D6_SOLCH5.899e-1734.03Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71... [more]
C98A1_SORBI7.704e-1729.41Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1... [more]
C71BU_ARATH7.704e-1734.11Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=C... [more]
C71BQ_ARATH1.006e-1632.37Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=C... [more]
C71BE_ARATH1.006e-1634.71Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D11EF DevOvary1 Citrus clementina cDNA clone C32003D11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876328 ID=FC876328|Name=FC876328|organism=Citrus clementina|type=EST|length=604bp
GGCGACTACTCGTACCATTTCTACACTTTCTCTGGGAAACGAAACAAAGA
GCAATGTCTACTTTACCACTACTGATACTGTACACATCACTTTTGGCAAT
TGTCATTTCTTTCCTTTTTAGCCTCCTCCGGAACAGACGCAGACACTCCT
CCCACCGTCTGCCTCCCGGTCCGAAACCCTGGCCAATAGTCGGAAACCTC
CCTCACTTGGGCCCTATGCCCCACCAATCCATAGCGGGTCTGGCCCGAAC
CCACGGCCCCCTCATGTACCTCCGGTTAGGCTTCGTTGACGTCGTCGTGG
CCGCTTCCGCTTCCGTGGCGGCCCAATTCCTGAAGATCCATGATTCCAAC
TTCTCCAACCGCCCTCCCAACTCCGGCGCCAAGCACATCGCTTACAACTA
TCAGGACATCGTTTTCCGGCCGTACGGCCCCCGCTGGCGGATGCTGAGGA
AGATCAGCTCCGTTCATCTTTTCTCCGGCAAGGCCTTGGATGACTACAGG
CACGTTCGCCAGGAAGAGATGGCGGTGCTCACGCGCGCGTTGGCGAGTGC
AGGAACGGAGCCGGTGAACTTAGCTCNACGGTTGAACTTGTGCGTTGTGA
ATGC
back to top