FC876329

Overview
NameFC876329
Unique NameFC876329
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length327
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:33..359. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHSY_CATRO (Chalcone synthase OS=Catharanthus roseus GN=CHS PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.729e-39
Identity = 77/98 (78.57%), Postives = 87/98 (88.78%), Query Frame = 2
Query:   26 MATVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            M  V+EIRNAQ A GPATVL IGT TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMC+KSMIKKRYM+LTEEIL+ENPN+CAYM PSLDARQ+IV
Sbjct:    1 MVNVEEIRNAQRAQGPATVLAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKRYMHLTEEILQENPNICAYMAPSLDARQNIV 98          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHSJ_PETHY (Chalcone synthase J OS=Petunia hybrida GN=CHSJ PE=2 SV=2)

HSP 1 Score: 160.999 bits (406), Expect = 1.729e-39
Identity = 76/98 (77.55%), Postives = 87/98 (88.78%), Query Frame = 2
Query:   26 MATVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            M TV+EIR AQ A+GPAT++ IGT TP++ V+Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKRYM+LTEEILKENPN+C YM PSLDARQDIV
Sbjct:    1 MVTVEEIRRAQRAEGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMHLTEEILKENPNICEYMAPSLDARQDIV 98          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHSE_IPOPU (Chalcone synthase E OS=Ipomoea purpurea GN=CHSE PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 2.258e-39
Identity = 75/98 (76.53%), Postives = 85/98 (86.73%), Query Frame = 2
Query:   26 MATVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            M TV+E+R AQ A GPAT++ IGT TP + V+Q+ YPDYYFRIT SEH+ ELKEKFKRMC+KSMIKKRYMYLTEEIL ENPN+CAYM PSLDARQDIV
Sbjct:    1 MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMIKKRYMYLTEEILTENPNICAYMAPSLDARQDIV 98          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHSY_VIGUN (Chalcone synthase OS=Vigna unguiculata GN=CHS PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 2.949e-39
Identity = 76/98 (77.55%), Postives = 87/98 (88.78%), Query Frame = 2
Query:   26 MATVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            M +V EIR AQ A+GPAT+L IGT TP + V+Q+ YPDYYFRIT SEHMT+LKEKF+RMCDKSMIKKRYM++TEEILKENP+MCAYM PSLDARQDIV
Sbjct:    1 MVSVSEIRQAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMCDKSMIKKRYMHVTEEILKENPSMCAYMAPSLDARQDIV 98          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHS6_SOYBN (Chalcone synthase 6 OS=Glycine max GN=CHS6 PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 2.949e-39
Identity = 75/98 (76.53%), Postives = 87/98 (88.78%), Query Frame = 2
Query:   26 MATVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            M +V+EIR AQ A+GPATV+ IGT TP + V+Q+ YPDYYFRIT S+HM ELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYM+PSLDARQD+V
Sbjct:    1 MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSDHMNELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMEPSLDARQDMV 98          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHS1_MAIZE (Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 6.569e-39
Identity = 75/96 (78.12%), Postives = 84/96 (87.50%), Query Frame = 2
Query:   32 TVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            TV E+R  Q A GPATVL IGT TPA+ V QADYPDYYFRITKS+H+T+LKEKFKRMCDKSMI+KRYM+LTEE L ENP+MCAYM PSLDARQD+V
Sbjct:    7 TVDEVRKGQRATGPATVLAIGTATPANCVYQADYPDYYFRITKSDHLTDLKEKFKRMCDKSMIRKRYMHLTEEFLSENPSMCAYMAPSLDARQDVV 102          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHSY_HYPAN (Chalcone synthase OS=Hypericum androsaemum PE=1 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 8.579e-39
Identity = 75/98 (76.53%), Postives = 83/98 (84.69%), Query Frame = 2
Query:   26 MATVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            M TV+E+R AQ A+GPATV+ IGT  P + V+QA YPDYYFRIT SEH  ELKEKF+RMCDKS IKKRYMYL EE+LKENPNMCAYM PSLDARQDIV
Sbjct:    1 MVTVEEVRKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKKRYMYLNEEVLKENPNMCAYMAPSLDARQDIV 98          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHSY_CHRAE (Chalcone synthase OS=Chrysosplenium americanum GN=CHS PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 1.120e-38
Identity = 75/97 (77.32%), Postives = 86/97 (88.66%), Query Frame = 2
Query:   29 ATVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            A ++EIRNAQ A+GPAT+L IGT TPA+ V QADYPD+YFRIT SEH TELKEKF+RMCDKSMIKKRYM+LTE++LKENP MC YM PSLDARQD+V
Sbjct:    5 ALMEEIRNAQRAEGPATILAIGTATPANCVIQADYPDFYFRITNSEHKTELKEKFQRMCDKSMIKKRYMHLTEDLLKENPKMCEYMAPSLDARQDMV 101          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHS6_IPOBA (Chalcone synthase DII OS=Ipomoea batatas GN=CHS-DII PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 1.120e-38
Identity = 75/97 (77.32%), Postives = 84/97 (86.60%), Query Frame = 2
Query:   26 MATVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDI 316
            M TV+E+R AQ A+GPAT+L IGT TPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YM PSLDARQDI
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDI 97          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHS8_IPOBA (Chalcone synthase DIV OS=Ipomoea batatas GN=CHS-DIV PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.463e-38
Identity = 75/97 (77.32%), Postives = 84/97 (86.60%), Query Frame = 2
Query:   26 MATVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDI 316
            M TV+E+R AQ A+GPAT+L IGT TPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YM PSLDARQDI
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDI 97          
The following BLAST results are available for this feature:
BLAST of FC876329 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 140
Match NameE-valueIdentityDescription
CHSY_CATRO1.729e-3978.57Chalcone synthase OS=Catharanthus roseus GN=CHS PE... [more]
CHSJ_PETHY1.729e-3977.55Chalcone synthase J OS=Petunia hybrida GN=CHSJ PE=... [more]
CHSE_IPOPU2.258e-3976.53Chalcone synthase E OS=Ipomoea purpurea GN=CHSE PE... [more]
CHSY_VIGUN2.949e-3977.55Chalcone synthase OS=Vigna unguiculata GN=CHS PE=2... [more]
CHS6_SOYBN2.949e-3976.53Chalcone synthase 6 OS=Glycine max GN=CHS6 PE=3 SV... [more]
CHS1_MAIZE6.569e-3978.13Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV... [more]
CHSY_HYPAN8.579e-3976.53Chalcone synthase OS=Hypericum androsaemum PE=1 SV... [more]
CHSY_CHRAE1.120e-3877.32Chalcone synthase OS=Chrysosplenium americanum GN=... [more]
CHS6_IPOBA1.120e-3877.32Chalcone synthase DII OS=Ipomoea batatas GN=CHS-DI... [more]
CHS8_IPOBA1.463e-3877.32Chalcone synthase DIV OS=Ipomoea batatas GN=CHS-DI... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D12EF DevOvary1 Citrus clementina cDNA clone C32003D12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876329 ID=FC876329|Name=FC876329|organism=Citrus clementina|type=EST|length=327bp
ATATTCATTAAGGGTTCAACTTGAAATGGCTACCGTTCAAGAGATCAGAA
ACGCTCAGTGAGCCGACGGTCCGGCCACCGTCCTCGGCATCGGTACGGAC
ACGCCTGCCCACAGTGTCAACCAAGCTGATTATCCCGACTATTACTTCAG
GATCACAAAGAGCGAGCATATGACGGAGCTTAAAGAGAAGTTCAAGCGCA
TGTGTGACAAGTCGATGATTAAGAAGCGTTACATGTACTTAACGGAAGAG
ATTTTGAAGGAAAACCCCAACATGTGCGCTTACATGGATCCATCACTCGA
CGCACGTCAAGACATTGTGGCGGGCGA
back to top