FC920178

Overview
NameFC920178
Unique NameFC920178
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length692
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_NOSCE (Probable phenylalanyl-tRNA synthetase alpha chain OS=Nosema ceranae (strain BRL01) GN=NCER_100038 PE=3 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 3.646e-59
Identity = 117/229 (51.09%), Postives = 151/229 (65.94%), Query Frame = 2
Query:    5 VKDLLLPVQNGHALSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            VK++L  V N     KEEIS LK RKLI       Y ++KGP Y  K     T+L  + +  G++K L FK YNFN KG     G LHPL+KVR++++ IFL+MGF EM TN FVESSFWNFD LFQPQ HP+RD+HDTFF++ PSTT  +P DY++ +K++H            +W  +EA KN+LR+HTTA S+R +  +A+  F   K FSIDRVFRNEA+D THL
Sbjct:  119 VKNMLNNVTN-KIYQKEEISLLKKRKLIYQAKEVVYFIKKGPLYG-KDSDNITELISKMVISGEYKHLNFKPYNFNTKGNIQSQGALHPLMKVREEIRKIFLEMGFNEMTTNKFVESSFWNFDTLFQPQNHPSRDAHDTFFMKTPSTTSYIPIDYMKMIKKIHSVGDFDSDGHFSDWDIKEAEKNILRSHTTACSTRTMLEIAKGEFISAKLFSIDRVFRNEALDATHL 345          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_SCHPO (Phenylalanyl-tRNA synthetase alpha chain OS=Schizosaccharomyces pombe GN=SPAC3G9.06 PE=2 SV=3)

HSP 1 Score: 226.483 bits (576), Expect = 1.061e-58
Identity = 116/223 (52.02%), Postives = 149/223 (66.82%), Query Frame = 2
Query:   29 QNGHALSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPE-DYVERVKRVHE-XXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            ++G     + ++ LK RKL+       +S+RKGPN++ + +K  TDLT E +    W+  +FK YNF A+G P  GG LHPL+KVR++ +  F ++GFEEMPTNNFVES FWNFDALF PQQH ARD+ DTFFL+ P++T +LP+ +YV RVK  HE             +  EE  K +LRTHTTAVS+ ML  LA+  F P KYFSIDRVFRNE VD THL
Sbjct:  145 EHGTISDSKTLTDLKKRKLVERNKIMYFSLRKGPNFSLQIEKLNTDLTAEMITSRSWESAKFKSYNFAAEGIPPAGGCLHPLMKVREEFRKFFFELGFEEMPTNNFVESGFWNFDALFVPQQHSARDAQDTFFLKVPASTDKLPDPEYVARVKATHENGGETKGIGYRAPFSLEETRKLVLRTHTTAVSANMLYKLAQNGFHPAKYFSIDRVFRNETVDATHL 367          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_DICDI (Phenylalanyl-tRNA synthetase alpha chain OS=Dictyostelium discoideum GN=pheSA PE=3 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 3.086e-58
Identity = 115/216 (53.24%), Postives = 141/216 (65.28%), Query Frame = 2
Query:   44 LSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            L  + +   K  + I  +    Y V KG  Y  KR K  +DLT E L+   W++  FK  N NA G   E G+ HPL KV+ + K IFL MGFEEMPT NFVE+ FWNFDALFQPQQHPAR+  DTFF+++P T+ +  ++Y ERVK+VH            +WK EEA KN+LRTHTTAVS+RML  LA+  F PKKYFSIDRVFRNE +D THL
Sbjct:  143 LDSKTLEQYKKSRFIEEKKLSYYRVTKGEQYN-KRSKELSDLTIEMLKDDSWEKESFK-VNINAMGVVPEQGYRHPLNKVKNEFKQIFLDMGFEEMPTFNFVENGFWNFDALFQPQQHPARELQDTFFIKDPKTSHDFSDEYCERVKQVHSVGGYGSLGWIYDWKLEEAEKNILRTHTTAVSARMLYKLAQNGFKPKKYFSIDRVFRNETLDATHL 356          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_ENCCU (Probable phenylalanyl-tRNA synthetase alpha chain OS=Encephalitozoon cuniculi GN=ECU07_1660 PE=3 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 8.404e-56
Identity = 106/229 (46.29%), Postives = 149/229 (65.07%), Query Frame = 2
Query:    5 VKDLLLPVQNGHALSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            V+++++ ++ G A S EE+ +L+ RKL+  +    +   KGP +        T+LT E +  G +++L FK YNFNA+G   + G +HPL+K+R+  + IF+++GF EM TN +VESSFWNFDALFQPQ HP+RD+HDTFFL  P  + + P DY++ V   H             W  +EA KN+LRTHTT+VS+R L  LA++ F P K FSID+VFRNE VD THL
Sbjct:  120 VRNMVISMKRGTA-SAEEVEALRKRKLVSRRKKIVFIATKGPMFFDNTSYV-TELTSEMVLDGSYRDLSFKHYNFNAEGNAPQCGSIHPLMKIREDFRRIFIELGFSEMATNQYVESSFWNFDALFQPQNHPSRDAHDTFFLLNPELSTDFPSDYLKEVGETHRGGKYNSLGYMSNWDIKEAQKNILRTHTTSVSARNLYRLAKKEFKPAKLFSIDKVFRNETVDATHL 346          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_YEAST (Phenylalanyl-tRNA synthetase alpha chain OS=Saccharomyces cerevisiae GN=FRS2 PE=1 SV=3)

HSP 1 Score: 212.231 bits (539), Expect = 2.070e-54
Identity = 109/235 (46.38%), Postives = 151/235 (64.26%), Query Frame = 2
Query:    2 KVKDLLLPVQNGHALSKEE---ISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPED--YVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            + + +L  ++N   L   +   ++ LK RKLI       ++V KGP ++    K  TDLT + +    +K+L+FK YNFN++G     G LHPL KVR++ + IF  MGF EMP+N +VE+ FWNFDAL+ PQQHPARD  DTF++++P  T +LP+D  Y++ +K VHE            WK EE  K +LRTH+TA+S+RML  LA++P  P + FSIDRVFRNEAVD THL
Sbjct:  137 ETQSILAQIKNNSHLDSIDAKILNDLKKRKLIAQGKITDFNVTKGPEFSTDLTKLETDLTSDMVSTNAYKDLKFKPYNFNSQGVQISSGALHPLNKVREEFRQIFFSMGFTEMPSNQYVETGFWNFDALYVPQQHPARDLQDTFYIKDP-LTADLPDDKTYMDNIKAVHEQGRFGSIGYRYNWKPEECQKLVLRTHSTAISARMLHDLAKDP-KPTRLFSIDRVFRNEAVDATHL 369          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_ENTBH (Probable phenylalanyl-tRNA synthetase alpha chain OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22775 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 4.783e-43
Identity = 99/239 (41.42%), Postives = 135/239 (56.49%), Query Frame = 2
Query:   26 VQNGHALSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEP--STTRELPEDYVERVKRVHEXXXXXXXXXXXE---------WKREEANKNLLRTHTTAVSSRMLKALAEEPFAPK------KYFSIDRVFRNEAVDRTHL 691
            ++N  ++SK+E   LK RKL+       Y + +G N+  ++K    +LT +NL       L  K+YNFN        G LHPL K++ + K IFL+MGF EM T  +VESSFWNFD+LFQPQ HP+R+  DTFFL+ P  +   ++   Y+ RV+ +H            +         W   EA KN+LRTHTTA+SS+ML  LA+     +      K FSID+VFRNE VD THL
Sbjct:  121 LRNLDSISKDEFEELKKRKLVDINKKNIYKITRGENFNIEQKDIINELTTQNLFNISDTSL-LKKYNFNLSKVSRFFGSLHPLTKIKSEFKRIFLEMGFSEMNTGKYVESSFWNFDSLFQPQNHPSREIQDTFFLKVPRLNDLNDVDSQYINRVESIHSSTSIPVDEGYDKCYSKGHNNVWSVAEAKKNILRTHTTAISSQMLYKLAQSNLKAEIKNYNIKLFSIDKVFRNETVDATHL 358          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_METKA (Phenylalanyl-tRNA synthetase alpha chain OS=Methanopyrus kandleri GN=pheS PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 4.336e-36
Identity = 87/178 (48.88%), Postives = 109/178 (61.24%), Query Frame = 2
Query:  161 TDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHE-XXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            T+L  E+L++G WKE EFK Y+  A   P   G  HPL +V  +++ IFL+MGF E+ +   VESSFWNFDALFQPQ H AR+  DTF+L+EP+      E+ VE+V+ VHE            EW    A K +LRTHTTAVS R L  + E P  P K FSI RV+R E VD  HL
Sbjct:  223 TELKPEHLREGTWKEKEFKPYDVKAPTSPTFPGKRHPLKEVINEIRRIFLEMGFVEV-SGPLVESSFWNFDALFQPQDHAAREMQDTFYLKEPAEAELPDEEVVEKVRAVHEDGGDTGSRGWGYEWDEGVARKTVLRTHTTAVSVRKLYEV-EGP--PLKAFSIGRVYRRETVDYKHL 396          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_ARCFU (Phenylalanyl-tRNA synthetase alpha chain OS=Archaeoglobus fulgidus GN=pheS PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 4.336e-36
Identity = 84/226 (37.17%), Postives = 126/226 (55.75%), Query Frame = 2
Query:   17 LLPVQNGHALSKEEISSLKARKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHE-XXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            L  ++ G  + +  + +L  RKL+     K   +        + +   TDLT E L +G W+  +F +Y+     +   GG +HP  ++ ++ + +FL+MGF E+   ++V+ +FWNFDALFQPQ HPARD  DTF+L+      +L  + VERVK  HE            EW  E+A + +LRTHTTA++   +  LAE P  P+K F IDRV+R E +D THL
Sbjct:  133 LQAIKEGRGVDEGTLKTLMKRKLVTKSETKQVYIEVMKKPEIELEDIITDLTPEMLLEGTWRGKQFLKYDITIPAKEIYGGKIHPYERIIEECRKVFLEMGFTEIK-GHYVQPAFWNFDALFQPQDHPARDMQDTFYLDR---YIDLEGEIVERVKATHENGWITGSTGWGGEWSLEKARQLVLRTHTTAIT---IHYLAENPEPPQKAFCIDRVYRRETIDATHL 351          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_METBF (Phenylalanyl-tRNA synthetase alpha chain OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pheS PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.068e-34
Identity = 88/232 (37.93%), Postives = 130/232 (56.03%), Query Frame = 2
Query:   35 GHALSKEEISS-------LKARKLIVP--QTWKGYSVRKGPNYAPKR----KKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHE-XXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            G A + EEI S       L  RKL++   + ++  S+    N    +    ++    LT E L+ G WK+ +F+ Y  +   +   G  +HP  ++ +Q++ IFL+MGF E+     ++SSFWNFDALFQPQ HPARD  DTF L   ++T ELP +Y E+V  +HE             W +E + +N+LRTHTT+V+   +K LA+ P +P K F IDR +R E +D TH
Sbjct:  144 GKAKTLEEIGSDQGTIKDLLKRKLVIKHEEKFRTVSITDAGNALATQGLVLEEEIAQLTPELLKSGAWKDKKFRPYRLDITPKSLYGAKIHPYRRLIEQMRQIFLEMGFAEIK-GGIIQSSFWNFDALFQPQDHPARDMQDTFHL---NSTCELPTEYFEKVAAMHEHGGDIDSCGWGGAWDKELSRRNVLRTHTTSVT---VKYLADHPKSPVKAFCIDRAYRRETIDPTH 368          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_METMA (Phenylalanyl-tRNA synthetase alpha chain OS=Methanosarcina mazei GN=pheS PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 3.108e-34
Identity = 86/217 (39.63%), Postives = 121/217 (55.76%), Query Frame = 2
Query:   59 ISSLKARKLIVPQTWKGYSVR---KGPNYAPKR---KKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXE-WKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            +  L  RKL+V    K  +V     G   A +    ++    LT E L+ G WKE +F+ Y  +   +P  G  +HP  ++ +Q++ IFL+MGF E+     ++SSFWNFDALFQPQ HPARD  DTF L    +T ++P +Y  +V  +HE             W RE A +N+LRTHTT+V+   +K LA+ P  P K F IDR +R E +D TH
Sbjct:  162 VKDLLKRKLVVKHEEKFRTVSITDAGSELASQGLVLEEEIAQLTPELLKSGAWKEKKFRPYRLDITPKPLYGTKIHPYRRLIEQMRQIFLEMGFTEIK-GGIIQSSFWNFDALFQPQDHPARDMQDTFHL---GSTCQIPAEYSGKVAAMHENGGDIDSCGWGGIWDRELAGRNVLRTHTTSVT---IKYLADNPEPPVKAFCIDRAYRRETIDPTH 371          
The following BLAST results are available for this feature:
BLAST of FC920178 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 74
Match NameE-valueIdentityDescription
SYFA_NOSCE3.646e-5951.09Probable phenylalanyl-tRNA synthetase alpha chain ... [more]
SYFA_SCHPO1.061e-5852.02Phenylalanyl-tRNA synthetase alpha chain OS=Schizo... [more]
SYFA_DICDI3.086e-5853.24Phenylalanyl-tRNA synthetase alpha chain OS=Dictyo... [more]
SYFA_ENCCU8.404e-5646.29Probable phenylalanyl-tRNA synthetase alpha chain ... [more]
SYFA_YEAST2.070e-5446.38Phenylalanyl-tRNA synthetase alpha chain OS=Saccha... [more]
SYFA_ENTBH4.783e-4341.42Probable phenylalanyl-tRNA synthetase alpha chain ... [more]
SYFA_METKA4.336e-3648.88Phenylalanyl-tRNA synthetase alpha chain OS=Methan... [more]
SYFA_ARCFU4.336e-3637.17Phenylalanyl-tRNA synthetase alpha chain OS=Archae... [more]
SYFA_METBF1.068e-3437.93Phenylalanyl-tRNA synthetase alpha chain OS=Methan... [more]
SYFA_METMA3.108e-3439.63Phenylalanyl-tRNA synthetase alpha chain OS=Methan... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A06EF RVDevelop1 Citrus clementina cDNA clone C32005A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920178 ID=FC920178|Name=FC920178|organism=Citrus clementina|type=EST|length=692bp
AAAAGTCAAAGATTTGCTTCTACCAGTACAAAATGGACATGCGCTTAGCA
AAGAGGAGATTAGCAGTCTCAAAGCACGGAAGCTTATTGTTCCCCAGACA
TGGAAGGGGTACTCAGTGAGAAAAGGTCCTAATTATGCTCCCAAAAGGAA
GAAAGCTGCTACAGATTTGACTCGAGAGAACCTTCAGAAGGGTGATTGGA
AGGAATTGGAGTTCAAAGAGTACAACTTCAATGCTAAAGGACAGCCTGCG
GAAGGTGGCCATCTTCACCCACTGCTCAAGGTGCGGAAGCAATTGAAGGA
CATATTTCTCCAGATGGGTTTTGAGGAGATGCCGACAAACAATTTTGTTG
AAAGCAGCTTCTGGAACTTTGATGCATTATTCCAGCCACAACAACACCCT
GCCCGTGATTCTCATGATACCTTCTTTCTGGAAGAACCTTCCACTACAAG
GGAACTACCAGAAGATTATGTTGAGCGGGTGAAGCGTGTGCACGAGTCTG
GTGGTTATGGGTCCAGAGGATATGGATATGAGTGGAAAAGAGAGGAAGCA
AACAAAAACCTTCTGCGAACTCATACAACTGCTGTCTCTTCCAGGATGCT
TAAGGCACTAGCTGAAGAACCTTTTGCCCCGAAAAAGTATTTCTCCATAG
ATCGTGTTTTCAGAAATGAAGCTGTTGATCGAACTCATCTTG
back to top