FC920178

Overview
NameFC920178
Unique NameFC920178
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length692
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_METMJ (Phenylalanyl-tRNA synthetase alpha chain OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pheS PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.181e-33
Identity = 88/228 (38.60%), Postives = 122/228 (53.51%), Query Frame = 2
Query:   29 QNGHALSKEEISSLKARKLIVPQTWKGYSVRKGP------NYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHE-XXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            + G     E ++ L  R L + +    Y+V   P      +     ++ A  LTRE +  G+WK L  + Y+     + A  G +HP  ++  +++ I   MGFEEM +   V+SSFWNFDALFQPQ HPAR+  DTFFL E    R LP  Y ERV+ +HE             W  E+A + +LRTHTT++S   ++ LA  P  P K F I RV+R EA+D THL
Sbjct:  137 EKGEIADGEGVADLAKRGLAIEEETVAYTVSITPRGRELLSQGLDLREEAGTLTREQILSGEWKSLPLRRYDVTKLPKRAYPGKVHPYQRIIDEMRRILFDMGFEEM-SGGIVQSSFWNFDALFQPQDHPAREMQDTFFLGE---RRPLPAGY-ERVRDMHEHGGETSSTGWGGTWSAEKAEQCVLRTHTTSLS---IQHLAAHPKPPVKAFCIGRVYRREAIDPTHL 356          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_METAC (Phenylalanyl-tRNA synthetase alpha chain OS=Methanosarcina acetivorans GN=pheS PE=3 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 2.631e-33
Identity = 85/223 (38.12%), Postives = 121/223 (54.26%), Query Frame = 2
Query:   41 ALSKEEISSLKARKLIVPQTWKGYSVR---KGPNYAPKR---KKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXE-WKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            A  +  +  L  RKL++    K  +V     G   A +    ++    LT E L+ G WK  +F+ Y  +    P  G  +HP  ++ +Q++ IFL+MGF E+     ++SSFWNFDALFQPQ HPARD  DTF L    +  +LP +Y ++V  +HE             W RE A +N+LRTHTT+V+   +K LA+ P  P K F IDR +R E +D TH
Sbjct:  153 AADEGTVKELLKRKLVIKHEEKSRTVSVTGAGSALAAEGIVLEEEIAQLTPELLKSGAWKGKKFRPYRLDIAPNPLYGVKIHPYRRLIEQMRQIFLEMGFTEIK-GGIIQSSFWNFDALFQPQDHPARDMQDTFHL---GSICQLPAEYSDKVAAMHESGGDIDSCGWGGIWDRELARRNVLRTHTTSVT---IKYLADNPEPPVKAFCIDRAYRRETIDPTH 368          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_METJA (Phenylalanyl-tRNA synthetase alpha chain OS=Methanocaldococcus jannaschii GN=pheS PE=3 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.436e-33
Identity = 81/206 (39.32%), Postives = 121/206 (58.74%), Query Frame = 2
Query:   77 RKLIVPQTWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALA-EEPFAPKKYFSIDRVFRNEAVDRTHL 691
            +++ +  T KG    K P    + ++  T LTR+ +  G WK+   + Y+     +P     +HPL ++ +++K+I L MGF+E+ +   VE+ FWNFD LF+PQ HPAR+  DTFFL+ P+   ++PED + +VK VHE           ++    + + +LRTHTTA S R L +L+ EE   P K F IDRVFRNEA+D  HL
Sbjct:  168 KEIKIKLTEKGKEFIKNPI---EIEEEITQLTRDIIISGKWKKAYIRPYDVKVPTKPIYPAKVHPLTRIIREVKEILLAMGFKEVKSP-IVETEFWNFDMLFEPQDHPAREMQDTFFLKYPN-EGDIPEDLLSKVKEVHE------RCWKYKFDENVSRRLILRTHTTASSIRYLASLSDEEKNKPHKVFCIDRVFRNEAIDYKHL 362          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_METTH (Phenylalanyl-tRNA synthetase alpha chain OS=Methanobacterium thermoautotrophicum GN=pheS PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.227e-32
Identity = 75/179 (41.90%), Postives = 106/179 (59.22%), Query Frame = 2
Query:  158 ATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHE-XXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            AT +T E+L+ G W++L ++ YN +A+      G +HPL ++  +++ IFL++GF E      VES+FWNFD LFQPQ H AR+  DTF+++ P+ T    ED V  V+  HE            EW R+ A +++LRTHTT VS+R L     EP  P K FS+ RVFR E +   HL
Sbjct:  212 ATQVTHEHLKSGAWRKLHYRGYNIDAEYPLVYPGKMHPLRRIIDEIRSIFLKLGFTES-RGPIVESAFWNFDCLFQPQDHAAREMQDTFYVKNPAVTDLPCEDLVRAVQDAHETGGSTGSEGWQYEWDRDVARQSVLRTHTTCVSARFLS--ENEP--PLKMFSVGRVFRRETITYKHL 385          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_METMP (Phenylalanyl-tRNA synthetase alpha chain OS=Methanococcus maripaludis GN=pheS PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 5.486e-31
Identity = 72/186 (38.71%), Postives = 110/186 (59.14%), Query Frame = 2
Query:  149 KKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEW--KREE--ANKNLLRTHTTAVSSRMLKALAE-EPFAPKKYFSIDRVFRNEAVDRTHL 691
            K+  T LTRE +  G WK+   + Y+     +       HP+ K+ +++ ++ + MGF+E+ +   V++ FWNFD LF+PQ HPARD  DTFF++ P+T + +P++ +E+VK +HE            W  K +E  + + +LRTHTT  S + L +L+E E   P K F IDRVFRNE +D  HL
Sbjct:  195 KEEITQLTREMIVSGKWKDYFIRPYDAKIPTEDIYPAKAHPMSKIIQEVNEVLISMGFKEVKSQ-IVQTEFWNFDTLFEPQDHPARDMQDTFFVKYPNTGK-VPKELLEKVKGIHECGTIDGEKISKGWCYKFDENVSKRTVLRTHTTVSSIKYLASLSESERENPHKVFCIDRVFRNETIDYKHL 378          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_METM7 (Phenylalanyl-tRNA synthetase alpha chain OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pheS PE=3 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.085e-30
Identity = 70/186 (37.63%), Postives = 107/186 (57.53%), Query Frame = 2
Query:  149 KKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEW----KREEANKNLLRTHTTAVSSRMLKALAE-EPFAPKKYFSIDRVFRNEAVDRTHL 691
            K+  T LTRE +  G W +   + Y+     +       HP+ K+ +++ ++ + MGF+E+ +   V++ FWNFD LF+PQ HPARD  DTFF++ P+ T  +P+D +E+VK +HE            W      + + + +LRTHTT  S + L +L+E E   P+K F IDRVFRNE +D  HL
Sbjct:  195 KEEITQLTREMIVSGKWNDYTIRPYDAKIPTEEIYPVKAHPMSKIIQEVNEVLISMGFKEVKSQ-IVQTEFWNFDTLFEPQDHPARDMQDTFFVKYPN-TGIVPKDLLEKVKGIHECGTIGSEKISKGWCYKFDEKVSERTVLRTHTTVSSIKYLASLSETERENPQKVFCIDRVFRNETIDYKHL 378          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_THEGJ (Phenylalanyl-tRNA synthetase alpha chain OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pheS PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.722e-30
Identity = 80/216 (37.04%), Postives = 113/216 (52.31%), Query Frame = 2
Query:   59 ISSLKARKLIVPQTWKGYSVR---KGPNYAPK--RKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            +  LK RK+   +T    +V     G   APK   K+  + LT E ++ G W+E+EF+ ++  A  +    G   P      +++   ++MGF EM  ++ +E+ FWNFDALFQPQ HPAR+  DT+ L+ P +     E+ VERVK  HE            W  E A   + R H TA+S R L    E    P KYF+I RVFR + +DRTHL
Sbjct:  164 VKELKRRKIGEEETVTERTVEITPAGEELAPKVELKREVSVLTPELIKSGKWREVEFRRFDIKAPVRRIYPGKKQPYRAFLDKIRRRLIEMGFIEMTVDSLIETQFWNFDALFQPQNHPAREWTDTYQLKYPKSGFLPEEELVERVKTAHERGLAGSRGWGYVWSPERAMLLMPRAHGTALSGRQLAKGVE---IPGKYFTIQRVFRPDVLDRTHL 376          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_METM5 (Phenylalanyl-tRNA synthetase alpha chain OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pheS PE=3 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.556e-30
Identity = 70/186 (37.63%), Postives = 106/186 (56.99%), Query Frame = 2
Query:  149 KKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEW----KREEANKNLLRTHTTAVSSRMLKALAE-EPFAPKKYFSIDRVFRNEAVDRTHL 691
            K+  T LTRE +  G W +   + Y+     +       HP+ K+ +++ ++ + MGF+E+ +   V++ FWNFD LF+PQ HPARD  DTFF++ P+ T  +P+D +E+VK +HE            W        + + +LRTHTT  S + L +L+E E    +K F IDRVFRNEA+D  HL
Sbjct:  195 KEEITQLTREMIVSGKWNDYFIRPYDAKIPTEELYPAKAHPMSKIIQEVNEVLISMGFKEVKSQ-IVQTEFWNFDTLFEPQDHPARDMQDTFFVKYPN-TGTVPKDLLEKVKGIHECGTIGDEKISKGWCYNFDENVSERTVLRTHTTVSSIKYLASLSECERENAQKVFCIDRVFRNEAIDYKHL 378          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_THEON (Phenylalanyl-tRNA synthetase alpha chain OS=Thermococcus onnurineus (strain NA1) GN=pheS PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.065e-30
Identity = 78/218 (35.78%), Postives = 112/218 (51.38%), Query Frame = 2
Query:   56 EISSLKARKLIVPQTWKGYSVRKGP------NYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            +++ LK RK+         +V   P      N   + K+  + LT E ++ G W+E+EFK +N  A  +    G   P      +++   ++MGF EM  ++ +E+ FWNFDALFQPQ HPAR+  DT+ L+ P +     ++ VERVK  HE            W  E A   + R H TA+S R L    E    P KYF+I RVFR + +DRTHL
Sbjct:  163 KVNDLKRRKIAEEDIVTERTVEITPEGEELANKGLELKEEVSTLTPELIKSGKWREVEFKRFNIQAPVRRIYPGKKQPYRAFLDKIRRRLIEMGFIEMTVDSLIETQFWNFDALFQPQNHPAREWTDTYQLKYPKSGYLPNKELVERVKTAHERGLAGSRGWGYVWSPERAMLLMPRAHGTALSGRQLAKGVE---IPGKYFTIQRVFRPDVLDRTHL 377          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_METLZ (Phenylalanyl-tRNA synthetase alpha chain OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pheS PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.065e-30
Identity = 73/184 (39.67%), Postives = 110/184 (59.78%), Query Frame = 2
Query:  146 RKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELP-EDYVERVKRVHE-XXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            R++ AT LTRE +  G+WK L  ++Y+ +   +   GG +HP  ++  +++D+  +MGF E    + V++SFWNFD+L+QPQ HPAR+  DTF L E     ELP  +  E+++ +H+            EW  E   K +LRTH+T++S   ++ LAE P  P K FSI RV+R E +D THL
Sbjct:  178 REEVAT-LTREQILSGEWKSLPLRKYSIDKLPKKIYGGRVHPNQQILDEIRDLLFEMGFTEFH-GSIVQNSFWNFDSLYQPQDHPAREMQDTFHLAE-----ELPLPNGWEKIRDIHKFGGDTGSTGWGGEWSPEVGKKCVLRTHSTSLS---IQYLAEHPNPPLKAFSISRVYRRETIDPTHL 351          
The following BLAST results are available for this feature:
BLAST of FC920178 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 74
Match NameE-valueIdentityDescription
SYFA_METMJ1.181e-3338.60Phenylalanyl-tRNA synthetase alpha chain OS=Methan... [more]
SYFA_METAC2.631e-3338.12Phenylalanyl-tRNA synthetase alpha chain OS=Methan... [more]
SYFA_METJA3.436e-3339.32Phenylalanyl-tRNA synthetase alpha chain OS=Methan... [more]
SYFA_METTH2.227e-3241.90Phenylalanyl-tRNA synthetase alpha chain OS=Methan... [more]
SYFA_METMP5.486e-3138.71Phenylalanyl-tRNA synthetase alpha chain OS=Methan... [more]
SYFA_METM72.085e-3037.63Phenylalanyl-tRNA synthetase alpha chain OS=Methan... [more]
SYFA_THEGJ2.722e-3037.04Phenylalanyl-tRNA synthetase alpha chain OS=Thermo... [more]
SYFA_METM53.556e-3037.63Phenylalanyl-tRNA synthetase alpha chain OS=Methan... [more]
SYFA_THEON6.065e-3035.78Phenylalanyl-tRNA synthetase alpha chain OS=Thermo... [more]
SYFA_METLZ6.065e-3039.67Phenylalanyl-tRNA synthetase alpha chain OS=Methan... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A06EF RVDevelop1 Citrus clementina cDNA clone C32005A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920178 ID=FC920178|Name=FC920178|organism=Citrus clementina|type=EST|length=692bp
AAAAGTCAAAGATTTGCTTCTACCAGTACAAAATGGACATGCGCTTAGCA
AAGAGGAGATTAGCAGTCTCAAAGCACGGAAGCTTATTGTTCCCCAGACA
TGGAAGGGGTACTCAGTGAGAAAAGGTCCTAATTATGCTCCCAAAAGGAA
GAAAGCTGCTACAGATTTGACTCGAGAGAACCTTCAGAAGGGTGATTGGA
AGGAATTGGAGTTCAAAGAGTACAACTTCAATGCTAAAGGACAGCCTGCG
GAAGGTGGCCATCTTCACCCACTGCTCAAGGTGCGGAAGCAATTGAAGGA
CATATTTCTCCAGATGGGTTTTGAGGAGATGCCGACAAACAATTTTGTTG
AAAGCAGCTTCTGGAACTTTGATGCATTATTCCAGCCACAACAACACCCT
GCCCGTGATTCTCATGATACCTTCTTTCTGGAAGAACCTTCCACTACAAG
GGAACTACCAGAAGATTATGTTGAGCGGGTGAAGCGTGTGCACGAGTCTG
GTGGTTATGGGTCCAGAGGATATGGATATGAGTGGAAAAGAGAGGAAGCA
AACAAAAACCTTCTGCGAACTCATACAACTGCTGTCTCTTCCAGGATGCT
TAAGGCACTAGCTGAAGAACCTTTTGCCCCGAAAAAGTATTTCTCCATAG
ATCGTGTTTTCAGAAATGAAGCTGTTGATCGAACTCATCTTG
back to top