FC920178

Overview
NameFC920178
Unique NameFC920178
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length692
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_PYRFU (Phenylalanyl-tRNA synthetase alpha chain OS=Pyrococcus furiosus GN=pheS PE=3 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.035e-29
Identity = 83/221 (37.56%), Postives = 112/221 (50.68%), Query Frame = 2
Query:   59 ISSLKARKL---------IVPQTWKGYS-VRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            I+ LK RK+         I   T KG   V+KG       K+  T LT E +  G W+E+EFK +N  A  +    G   P      +++   ++MGF E+  ++ +E+ FWNFDALFQPQ HPAR+  DT+ L+ P        + VERVK  HE            W  E A   + R H TA+S+R L    E    P KYF+I RVFR + +DRTHL
Sbjct:  163 INELKRRKVAQEEEVVERIAEITEKGVELVKKGIEL----KREVTSLTPELIASGKWREVEFKPFNIKAPVKKIYPGKKQPYRVFLDKIRRKLIEMGFIEITVDSLIETQFWNFDALFQPQNHPAREWTDTYQLKYPEKGYLPNRELVERVKEAHERGLAGSRGWGYVWSPERAMFLMPRAHATALSARQLAKGIE---IPGKYFTIQRVFRPDVLDRTHL 376          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_METVS (Phenylalanyl-tRNA synthetase alpha chain OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pheS PE=3 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.931e-29
Identity = 73/203 (35.96%), Postives = 109/203 (53.69%), Query Frame = 2
Query:   98 TWKGYSVRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEW----KREEANKNLLRTHTTAVSSRMLKALA-EEPFAPKKYFSIDRVFRNEAVDRTHL 691
            T KG    K P    + K+  T +TR+ +  G WKE+  + Y+     +       HP+ K+ +++ ++   MGF E+ +   V++ FWNFD LF+PQ HPARD  DTFF++ P  T  +P + +++VK +HE            W      E + + +LRTHTT  S + L +L+ EE     K F IDRVFRNE +D  HL
Sbjct:  181 TVKGLEYIKNPI---EIKEEVTQITRDLIVSGKWKEVSIRPYDAKIPTEEIYPAKAHPMSKIIEEVTEVLTSMGFSEVKSQ-IVQTEFWNFDTLFEPQDHPARDMQDTFFVKYPD-TGIVPHELLKKVKSIHECGKIENEKISKGWCYKFDEEVSKRTVLRTHTTVSSIKYLSSLSNEEKENFHKVFCIDRVFRNETIDYKHL 378          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_THEVO (Phenylalanyl-tRNA synthetase alpha chain OS=Thermoplasma volcanium GN=pheS PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.706e-29
Identity = 65/165 (39.39%), Postives = 99/165 (60.00%), Query Frame = 2
Query:  197 WKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            WK   F++Y+ +A   P +    HPL+    +++ IFL MGF EM + +++ES+ W+ DALF PQ HPARD  DTF++++ + T E PE   +R+KR+HE            W  ++  K +LRTHTT  ++R    L E    P+  FS+++VFR+E+VD  HL
Sbjct:  202 WKTAPFRKYDLDAPVSPTKSYAKHPLVYFINEIRRIFLDMGFTEM-SGHYIESALWDMDALFIPQDHPARDMQDTFYVKDSNFTIEHPE-IEKRIKRIHERGFDGYSGWGYRWSSDDGKKLILRTHTTVTTARY---LYEHNTYPQAIFSVEKVFRHESVDWKHL 361          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_PYRAB (Phenylalanyl-tRNA synthetase alpha chain OS=Pyrococcus abyssi GN=pheS PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.706e-29
Identity = 71/181 (39.23%), Postives = 95/181 (52.49%), Query Frame = 2
Query:  149 KKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            K+  T LT E +  G W+E+E K +N  A  +    G   P      +++   ++MGF EM  ++ +E+ FWNFDALFQPQ HPAR+  DT+ L+ P       E  V RVK  HE            W  E A   + R H TA+S+R L    E    P KYF+I RVFR + +DRTHL
Sbjct:  200 KREVTRLTPELIASGKWREVELKPFNIKAPVKRIYPGKKQPYRVFLDKIRRRLIEMGFIEMTVDSLIETQFWNFDALFQPQNHPAREWTDTYQLKYPEKGYLPDESLVSRVKEAHERGLAGSRGWGYVWSPERAMLLMPRAHATALSARQLAKGIE---IPGKYFTIQRVFRPDVLDRTHL 377          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_PYRHO (Phenylalanyl-tRNA synthetase alpha chain OS=Pyrococcus horikoshii GN=pheS PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.144e-28
Identity = 88/243 (36.21%), Postives = 120/243 (49.38%), Query Frame = 2
Query:   11 DLLLPVQNGHALSKEEISS------LKARKLI---------VPQTWKGYS-VRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            D+ L V +   +S EEI        LK RK+          V  T KG   V KG       K+  + LT E +  G W+E+EFK +N  A  +    G   P      +++   ++MGF EM  ++ +E+ FWNFDALFQPQ HPAR+  DT+ L+ P       E+ V +VK  HE            W  E A   + R H TA+S+R    LA+    P KYF+I RVFR + +DRTHL
Sbjct:  141 DIALEVLSKGEVSVEEIEKIISVKELKRRKIAEEEEKVIRNVEITDKGLELVEKGIEL----KREVSILTPELIVTGKWREVEFKPFNIKAPVKKIYPGKKQPYRVFLDKIRRRLIEMGFIEMTVDSLIETQFWNFDALFQPQNHPAREWTDTYQLKYPEKGYLPDENLVSKVKEAHERGLAGSRGWGYVWSPERAMLLMPRAHATALSAR---ELAKGIEIPGKYFTIQRVFRPDVLDRTHL 376          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_METHJ (Phenylalanyl-tRNA synthetase alpha chain OS=Methanospirillum hungatei (strain JF-1 / DSM 864) GN=pheS PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.548e-28
Identity = 69/176 (39.20%), Postives = 102/176 (57.95%), Query Frame = 2
Query:  167 LTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHE-XXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            LT + +  G WK+L  + Y+     +P   G +HP  ++  +++ I L MGF E+   + ++ +FWNFDALFQPQ HPAR+  DTF L   +  +ELP  + E+V+ +HE            +W  E+A   +LRTHTT++S   ++ LA  P  P K F I RV+R EA+D THL
Sbjct:  185 LTADQISSGAWKDLSLRRYDITKHPRPVWPGKIHPYQRMIDEMRRILLDMGFTELH-GSIIQGAFWNFDALFQPQDHPAREMQDTFHL---AGKQELPVGW-EKVRDMHESGGETSSTGWGGKWDPEKAKATVLRTHTTSLS---IQHLAAHPEPPVKAFCIGRVYRREAIDPTHL 352          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_THEAC (Phenylalanyl-tRNA synthetase alpha chain OS=Thermoplasma acidophilum GN=pheS PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.652e-27
Identity = 62/170 (36.47%), Postives = 99/170 (58.24%), Query Frame = 2
Query:  182 LQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            +  G+WK   F++Y+ N+          HP+  + +++++IFL MGF EM   +++ES+ W+ D+LF PQ HPARD  DTF++E  S   + PE   ++++++HE            W   EA K +LRTHTT  ++R    L E    P+  FS+++VFR+E+VD  HL
Sbjct:  203 IASGEWKTKNFRKYDLNSPSSVIRSSLKHPMTYLIEEIREIFLNMGFTEMG-GHYIESTLWDMDSLFIPQDHPARDMQDTFYVEADSFDIDHPE-ISKKIRKIHEKGFDGYSGWGYRWSDAEARKLVLRTHTTVSTARY---LYENNEPPQAIFSVEKVFRHESVDWKHL 367          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_PYRKO (Phenylalanyl-tRNA synthetase alpha chain OS=Pyrococcus kodakaraensis GN=pheS PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.652e-27
Identity = 85/244 (34.84%), Postives = 120/244 (49.18%), Query Frame = 2
Query:    8 KDLLLPVQNGHALSKE-----EISSLKARKL---------IVPQTWKGYS-VRKGPNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHE-XXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            K L L  + G    KE      ++ LK RK+         +   T KG   V+KG       KK  + LT E ++ G W+E+EF++++  A  +    G   P      +++   ++MGF EM  ++ +E+ FWNFDALFQPQ HPAR+  DT+ L+ P       E+ V RVK  HE             W  E A   + R H TA+ +R L    E    P KYF+I RVFR + +DRTHL
Sbjct:  142 KALKLLAERGEVPVKEIEKLVPVNELKRRKIGEEDVITERVAEITEKGEELVKKGLEL----KKEVSVLTPELIKSGKWREVEFRKFDIKAPVRRIYPGKKQPYRAFLDKIRRRLIEMGFIEMTVDSLIETQFWNFDALFQPQNHPAREWTDTYQLKYPKVGSLPDEELVARVKAAHEHGGDTGSRGWGYVWSPERAMLLMPRAHGTALDARQLAKGVE---IPGKYFTIQRVFRPDVLDRTHL 378          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_HALSA (Phenylalanyl-tRNA synthetase alpha chain OS=Halobacterium salinarium GN=pheS PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.157e-27
Identity = 67/178 (37.64%), Postives = 100/178 (56.18%), Query Frame = 2
Query:  164 DLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVH-EXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAE-EPFAPKKYFSIDRVFRNEAVDRTHL 691
            +LT E L  G+W ++EF +YN  A       G  H L +  +++ D+ + MGF+EM     V++ F+  D LF PQ HPAR+  D F L  P+   ELP+  VERV+R H E            W  + A    LR HTT++++R L  LA+ +  AP +YFS+++ +RN+ +D THL
Sbjct:  201 ELTPELLASGEWADVEFADYNVAADAADHTPGKTHVLRQAAERVTDVLVGMGFQEM-AGPHVDADFYINDCLFMPQDHPARNHWDRFALSNPARIDELPDALVERVERAHREGAGDDGDGYHSPWDEDFARALALRGHTTSLTARHLAGLADADVEAPARYFSVEKAYRNDTLDATHL 377          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_HALS3 (Phenylalanyl-tRNA synthetase alpha chain OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pheS PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.157e-27
Identity = 67/178 (37.64%), Postives = 100/178 (56.18%), Query Frame = 2
Query:  164 DLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVH-EXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAE-EPFAPKKYFSIDRVFRNEAVDRTHL 691
            +LT E L  G+W ++EF +YN  A       G  H L +  +++ D+ + MGF+EM     V++ F+  D LF PQ HPAR+  D F L  P+   ELP+  VERV+R H E            W  + A    LR HTT++++R L  LA+ +  AP +YFS+++ +RN+ +D THL
Sbjct:  201 ELTPELLASGEWADVEFADYNVAADAADHTPGKTHVLRQAAERVTDVLVGMGFQEM-AGPHVDADFYINDCLFMPQDHPARNHWDRFALSNPARIDELPDALVERVERAHREGAGDDGDGYHSPWDEDFARALALRGHTTSLTARHLAGLADADVEAPARYFSVEKAYRNDTLDATHL 377          
The following BLAST results are available for this feature:
BLAST of FC920178 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 74
Match NameE-valueIdentityDescription
SYFA_PYRFU1.035e-2937.56Phenylalanyl-tRNA synthetase alpha chain OS=Pyroco... [more]
SYFA_METVS3.931e-2935.96Phenylalanyl-tRNA synthetase alpha chain OS=Methan... [more]
SYFA_THEVO6.706e-2939.39Phenylalanyl-tRNA synthetase alpha chain OS=Thermo... [more]
SYFA_PYRAB6.706e-2939.23Phenylalanyl-tRNA synthetase alpha chain OS=Pyroco... [more]
SYFA_PYRHO1.144e-2836.21Phenylalanyl-tRNA synthetase alpha chain OS=Pyroco... [more]
SYFA_METHJ2.548e-2839.20Phenylalanyl-tRNA synthetase alpha chain OS=Methan... [more]
SYFA_THEAC1.652e-2736.47Phenylalanyl-tRNA synthetase alpha chain OS=Thermo... [more]
SYFA_PYRKO1.652e-2734.84Phenylalanyl-tRNA synthetase alpha chain OS=Pyroco... [more]
SYFA_HALSA2.157e-2737.64Phenylalanyl-tRNA synthetase alpha chain OS=Haloba... [more]
SYFA_HALS32.157e-2737.64Phenylalanyl-tRNA synthetase alpha chain OS=Haloba... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A06EF RVDevelop1 Citrus clementina cDNA clone C32005A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920178 ID=FC920178|Name=FC920178|organism=Citrus clementina|type=EST|length=692bp
AAAAGTCAAAGATTTGCTTCTACCAGTACAAAATGGACATGCGCTTAGCA
AAGAGGAGATTAGCAGTCTCAAAGCACGGAAGCTTATTGTTCCCCAGACA
TGGAAGGGGTACTCAGTGAGAAAAGGTCCTAATTATGCTCCCAAAAGGAA
GAAAGCTGCTACAGATTTGACTCGAGAGAACCTTCAGAAGGGTGATTGGA
AGGAATTGGAGTTCAAAGAGTACAACTTCAATGCTAAAGGACAGCCTGCG
GAAGGTGGCCATCTTCACCCACTGCTCAAGGTGCGGAAGCAATTGAAGGA
CATATTTCTCCAGATGGGTTTTGAGGAGATGCCGACAAACAATTTTGTTG
AAAGCAGCTTCTGGAACTTTGATGCATTATTCCAGCCACAACAACACCCT
GCCCGTGATTCTCATGATACCTTCTTTCTGGAAGAACCTTCCACTACAAG
GGAACTACCAGAAGATTATGTTGAGCGGGTGAAGCGTGTGCACGAGTCTG
GTGGTTATGGGTCCAGAGGATATGGATATGAGTGGAAAAGAGAGGAAGCA
AACAAAAACCTTCTGCGAACTCATACAACTGCTGTCTCTTCCAGGATGCT
TAAGGCACTAGCTGAAGAACCTTTTGCCCCGAAAAAGTATTTCTCCATAG
ATCGTGTTTTCAGAAATGAAGCTGTTGATCGAACTCATCTTG
back to top