FC920178

Overview
NameFC920178
Unique NameFC920178
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length692
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_PYRAR (Phenylalanyl-tRNA synthetase alpha chain OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=pheS PE=3 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.354e-21
Identity = 63/187 (33.69%), Postives = 94/187 (50.27%), Query Frame = 2
Query:  128 PNYAPKRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            P  + +  +  T +T  ++  G W+    K ++   +         H   +    ++++ + +GFEE+     +E  FWNFDALFQ Q HPAR+ HDTF++         PE  +E V RVHE           +W RE+A   +LRT TTAV+   ++ALAE      K F+I RVFR E +D  H
Sbjct:  172 PPESVRPAEVKTAITSADIATGRWRTYLLKPFDLGVEPPEYPAPVPHFFNEFLDYVREVMIGLGFEEV-RGPVLEVEFWNFDALFQAQDHPAREVHDTFYIRWEGPIEAPPEHLLEAVGRVHE------EKWRYKWSREKALNPVLRTQTTAVT---IRALAERGDGEYKVFTIGRVFRPEKLDPKH 348          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_SULAC (Phenylalanyl-tRNA synthetase alpha chain OS=Sulfolobus acidocaldarius GN=pheS PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.146e-20
Identity = 60/177 (33.90%), Postives = 95/177 (53.67%), Query Frame = 2
Query:  161 TDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            T LT E L+  DWK+ + +EYN  A          H      ++LKD+  ++GF E+    ++E   +NFD LFQ Q HPAR+ HD+F ++      +  E  ++ +K +HE            W  + A + +LR+ TTAV++R+   L+  P  P K FS+ +VFR +++D THL
Sbjct:  179 TQLTSELLRSKDWKKYKIREYNVEALPPYFPLAKKHFFRDFIEKLKDVMKELGFTEVNAG-YIEMELYNFDLLFQAQDHPAREIHDSFRVDGLGKIDD--ERLLKEIKEMHE------KGWKYSWDPQIAKRLVLRSQTTAVTARI---LSSRPSVPFKGFSLGKVFRPDSIDATHL 343          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BORBU (Phenylalanyl-tRNA synthetase alpha chain OS=Borrelia burgdorferi GN=pheS PE=3 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 5.690e-20
Identity = 60/177 (33.90%), Postives = 87/177 (49.15%), Query Frame = 2
Query:  161 TDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNL-LRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            T LT E L+   ++  +F+ YN +        G  +  L    ++KD  + +GF+E      VE+ F+N DALF PQ HP+RD  D +++ +PS    LPE Y   VK  HE               E+ +K L LRTH T +S++ L         P +YF + R FR + VD TH
Sbjct:  226 TKLTPEILKNKTYENKKFRAYNIHIPSAKTFIGRANSYLDYISKIKDKLVGLGFQEFD-GPLVETEFFNNDALFMPQFHPSRDIKDVYYISDPSMQESLPEPYFSNVKLAHETGYATGSRGWRYSFSEDLSKRLVLRTHGTVLSAKQLINAKN----PSRYFGVIRCFRYDQVDATH 397          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_THETH (Phenylalanyl-tRNA synthetase alpha chain OS=Thermus thermophilus GN=pheS PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.315e-13
Identity = 73/242 (30.17%), Postives = 109/242 (45.04%), Query Frame = 2
Query:    5 VKDLLLPVQNGHALSKEEISSLKARKL----IVPQTWKGYSV-------RKGP--NYAPKRKKAATDLTRENLQKGDWKE-LEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            +++ L  +QN   L  EE+ +LKAR L    ++ Q  KG S        ++G   N      +AA +   + L++   KE LE +  + +  G     G LHP+  + ++L +IF  +G++ +     VES F+NFDAL  P+ HPARD  DTF+L       E P                           E   + LLRTHT+ +  R +  +A  P  P +     RVFR E  D TH
Sbjct:    2 LEEALAAIQNARDL--EELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQAVEGPE-VESEFFNFDALNIPEHHPARDMWDTFWLTGEGFRLEGP------------------------LGEEVEGRLLLRTHTSPMQVRYM--VAHTP--PFRIVVPGRVFRFEQTDATH 212          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_THET8 (Phenylalanyl-tRNA synthetase alpha chain OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pheS PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.315e-13
Identity = 73/242 (30.17%), Postives = 109/242 (45.04%), Query Frame = 2
Query:    5 VKDLLLPVQNGHALSKEEISSLKARKL----IVPQTWKGYSV-------RKGP--NYAPKRKKAATDLTRENLQKGDWKE-LEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            +++ L  +QN   L  EE+ +LKAR L    ++ Q  KG S        ++G   N      +AA +   + L++   KE LE +  + +  G     G LHP+  + ++L +IF  +G++ +     VES F+NFDAL  P+ HPARD  DTF+L       E P                           E   + LLRTHT+ +  R +  +A  P  P +     RVFR E  D TH
Sbjct:    2 LEEALAAIQNARDL--EELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQAVEGPE-VESEFFNFDALNIPEHHPARDMWDTFWLTGEGFRLEGP------------------------LGEEVEGRLLLRTHTSPMQVRYM--VAHTP--PFRIVVPGRVFRFEQTDATH 212          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_THET2 (Phenylalanyl-tRNA synthetase alpha chain OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pheS PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.315e-13
Identity = 73/242 (30.17%), Postives = 109/242 (45.04%), Query Frame = 2
Query:    5 VKDLLLPVQNGHALSKEEISSLKARKL----IVPQTWKGYSV-------RKGP--NYAPKRKKAATDLTRENLQKGDWKE-LEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            +++ L  +QN   L  EE+ +LKAR L    ++ Q  KG S        ++G   N      +AA +   + L++   KE LE +  + +  G     G LHP+  + ++L +IF  +G++ +     VES F+NFDAL  P+ HPARD  DTF+L       E P                           E   + LLRTHT+ +  R +  +A  P  P +     RVFR E  D TH
Sbjct:    2 LEEALAAIQNARDL--EELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQAVEGPE-VESEFFNFDALNIPEHHPARDMWDTFWLAGEGFRLEGP------------------------LGEEVEGRLLLRTHTSPMQVRYM--VAHTP--PFRIVVPGRVFRFEQTDATH 212          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_FERNB (Phenylalanyl-tRNA synthetase alpha chain OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=pheS PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.960e-12
Identity = 57/183 (31.15%), Postives = 83/183 (45.36%), Query Frame = 2
Query:  143 KRKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTHL 691
            ++K+  T+  +E   K  W +           G     GHLH L KVR +L+DIF+ MGF  +     VE+ ++NFDAL  P+ HPARD HD+F+++                                       N++LLRTHT+ V  R +  L+ +P  P    S  RV+R +  D THL
Sbjct:   76 EQKEKITEYEKEEAYKKLWVDPTMP-------GAIRSVGHLHILTKVRNELEDIFISMGFSVVEGPE-VETPWFNFDALNTPEWHPARDEHDSFYID---------------------------------------NEHLLRTHTSPVQIRTM--LSRKP--PLAIVSPGRVYRRD-YDATHL 206          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BACWK (Phenylalanyl-tRNA synthetase alpha chain OS=Bacillus weihenstephanensis (strain KBAB4) GN=pheS PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.448e-12
Identity = 46/150 (30.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 GQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            G+P E G  HPL  V +Q++D+F+ MG+E +     VE  ++NF+AL  P+ HPARD  DTF++ E                                       + LLRTHT++V +R ++   E+   P K     +V+R +  D TH
Sbjct:   99 GRPVETGCHHPLTAVVEQIEDVFIGMGYE-VAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITE---------------------------------------ETLLRTHTSSVQARTMEKNKEK--GPIKIICPGKVYRRDDDDATH 206          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BACCN (Phenylalanyl-tRNA synthetase alpha chain OS=Bacillus cereus subsp. cytotoxis (strain NVH 391-98) GN=pheS PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.448e-12
Identity = 50/171 (29.24%), Postives = 79/171 (46.20%), Query Frame = 2
Query:  179 NLQKGDWK-ELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            NL+K   + +L  +  +    G+P E G  HPL  V +Q++D+F+ MG+E +     VE  ++NF+AL  P+ HPARD  DTF++ E                                       + LLRTHT++V +R ++   E+   P K     +V+R +  D TH
Sbjct:   78 NLEKAVMEAKLASETIDVTLPGRPVETGCHHPLTAVVEQIEDVFIGMGYE-VAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITE---------------------------------------ETLLRTHTSSVQARTMENNKEK--GPIKIICPGKVYRRDDDDATH 206          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BACHK (Phenylalanyl-tRNA synthetase alpha chain OS=Bacillus thuringiensis subsp. konkukian GN=pheS PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.728e-12
Identity = 46/150 (30.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 GQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            G+P E G  HPL  V +Q++D+F+ MG+E +     VE  ++NF+AL  P+ HPARD  DTF++ E                                       + LLRTHT++V +R ++   E+   P K     +V+R +  D TH
Sbjct:   99 GRPVETGCHHPLTAVVEQIEDVFIGMGYE-VAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITE---------------------------------------ETLLRTHTSSVQARTMENNKEK--GPIKIICPGKVYRRDDDDATH 206          
The following BLAST results are available for this feature:
BLAST of FC920178 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 74
Match NameE-valueIdentityDescription
SYFA_PYRAR1.354e-2133.69Phenylalanyl-tRNA synthetase alpha chain OS=Pyroba... [more]
SYFA_SULAC1.146e-2033.90Phenylalanyl-tRNA synthetase alpha chain OS=Sulfol... [more]
SYFA_BORBU5.690e-2033.90Phenylalanyl-tRNA synthetase alpha chain OS=Borrel... [more]
SYFA_THETH2.315e-1330.17Phenylalanyl-tRNA synthetase alpha chain OS=Thermu... [more]
SYFA_THET82.315e-1330.17Phenylalanyl-tRNA synthetase alpha chain OS=Thermu... [more]
SYFA_THET22.315e-1330.17Phenylalanyl-tRNA synthetase alpha chain OS=Thermu... [more]
SYFA_FERNB1.960e-1231.15Phenylalanyl-tRNA synthetase alpha chain OS=Fervid... [more]
SYFA_BACWK7.448e-1230.67Phenylalanyl-tRNA synthetase alpha chain OS=Bacill... [more]
SYFA_BACCN7.448e-1229.24Phenylalanyl-tRNA synthetase alpha chain OS=Bacill... [more]
SYFA_BACHK9.728e-1230.67Phenylalanyl-tRNA synthetase alpha chain OS=Bacill... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A06EF RVDevelop1 Citrus clementina cDNA clone C32005A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920178 ID=FC920178|Name=FC920178|organism=Citrus clementina|type=EST|length=692bp
AAAAGTCAAAGATTTGCTTCTACCAGTACAAAATGGACATGCGCTTAGCA
AAGAGGAGATTAGCAGTCTCAAAGCACGGAAGCTTATTGTTCCCCAGACA
TGGAAGGGGTACTCAGTGAGAAAAGGTCCTAATTATGCTCCCAAAAGGAA
GAAAGCTGCTACAGATTTGACTCGAGAGAACCTTCAGAAGGGTGATTGGA
AGGAATTGGAGTTCAAAGAGTACAACTTCAATGCTAAAGGACAGCCTGCG
GAAGGTGGCCATCTTCACCCACTGCTCAAGGTGCGGAAGCAATTGAAGGA
CATATTTCTCCAGATGGGTTTTGAGGAGATGCCGACAAACAATTTTGTTG
AAAGCAGCTTCTGGAACTTTGATGCATTATTCCAGCCACAACAACACCCT
GCCCGTGATTCTCATGATACCTTCTTTCTGGAAGAACCTTCCACTACAAG
GGAACTACCAGAAGATTATGTTGAGCGGGTGAAGCGTGTGCACGAGTCTG
GTGGTTATGGGTCCAGAGGATATGGATATGAGTGGAAAAGAGAGGAAGCA
AACAAAAACCTTCTGCGAACTCATACAACTGCTGTCTCTTCCAGGATGCT
TAAGGCACTAGCTGAAGAACCTTTTGCCCCGAAAAAGTATTTCTCCATAG
ATCGTGTTTTCAGAAATGAAGCTGTTGATCGAACTCATCTTG
back to top