FC920178

Overview
NameFC920178
Unique NameFC920178
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length692
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BACCZ (Phenylalanyl-tRNA synthetase alpha chain OS=Bacillus cereus (strain ZK / E33L) GN=pheS PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.728e-12
Identity = 46/150 (30.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 GQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            G+P E G  HPL  V +Q++D+F+ MG+E +     VE  ++NF+AL  P+ HPARD  DTF++ E                                       + LLRTHT++V +R ++   E+   P K     +V+R +  D TH
Sbjct:   99 GRPVETGCHHPLTAVVEQIEDVFIGMGYE-VAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITE---------------------------------------ETLLRTHTSSVQARTMENNKEK--GPIKIICPGKVYRRDDDDATH 206          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BACCR (Phenylalanyl-tRNA synthetase alpha chain OS=Bacillus cereus (strain ATCC 14579 / DSM 31) GN=pheS PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.728e-12
Identity = 46/150 (30.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 GQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            G+P E G  HPL  V +Q++D+F+ MG+E +     VE  ++NF+AL  P+ HPARD  DTF++ E                                       + LLRTHT++V +R ++   E+   P K     +V+R +  D TH
Sbjct:   99 GRPVETGCHHPLTAVVEQIEDVFIGMGYE-VAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITE---------------------------------------ETLLRTHTSSVQARTMENNKEK--GPIKIICPGKVYRRDDDDATH 206          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BACCQ (Phenylalanyl-tRNA synthetase alpha chain OS=Bacillus cereus (strain Q1) GN=pheS PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.728e-12
Identity = 46/150 (30.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 GQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            G+P E G  HPL  V +Q++D+F+ MG+E +     VE  ++NF+AL  P+ HPARD  DTF++ E                                       + LLRTHT++V +R ++   E+   P K     +V+R +  D TH
Sbjct:   99 GRPVETGCHHPLTAVVEQIEDVFIGMGYE-VAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITE---------------------------------------ETLLRTHTSSVQARTMENNKEK--GPIKIICPGKVYRRDDDDATH 206          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BACC7 (Phenylalanyl-tRNA synthetase alpha chain OS=Bacillus cereus (strain AH187) GN=pheS PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.728e-12
Identity = 46/150 (30.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 GQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            G+P E G  HPL  V +Q++D+F+ MG+E +     VE  ++NF+AL  P+ HPARD  DTF++ E                                       + LLRTHT++V +R ++   E+   P K     +V+R +  D TH
Sbjct:   99 GRPVETGCHHPLTAVVEQIEDVFIGMGYE-VAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITE---------------------------------------ETLLRTHTSSVQARTMENNKEK--GPIKIICPGKVYRRDDDDATH 206          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BACC4 (Phenylalanyl-tRNA synthetase alpha chain OS=Bacillus cereus (strain B4264) GN=pheS PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.728e-12
Identity = 46/150 (30.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 GQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            G+P E G  HPL  V +Q++D+F+ MG+E +     VE  ++NF+AL  P+ HPARD  DTF++ E                                       + LLRTHT++V +R ++   E+   P K     +V+R +  D TH
Sbjct:   99 GRPVETGCHHPLTAVVEQIEDVFIGMGYE-VAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITE---------------------------------------ETLLRTHTSSVQARTMENNKEK--GPIKIICPGKVYRRDDDDATH 206          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BACC3 (Phenylalanyl-tRNA synthetase alpha chain OS=Bacillus cereus (strain 03BB102) GN=pheS PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.728e-12
Identity = 46/150 (30.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 GQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            G+P E G  HPL  V +Q++D+F+ MG+E +     VE  ++NF+AL  P+ HPARD  DTF++ E                                       + LLRTHT++V +R ++   E+   P K     +V+R +  D TH
Sbjct:   99 GRPVETGCHHPLTAVVEQIEDVFIGMGYE-VAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITE---------------------------------------ETLLRTHTSSVQARTMENNKEK--GPIKIICPGKVYRRDDDDATH 206          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BACC2 (Phenylalanyl-tRNA synthetase alpha chain OS=Bacillus cereus (strain G9842) GN=pheS PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.728e-12
Identity = 46/150 (30.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 GQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            G+P E G  HPL  V +Q++D+F+ MG+E +     VE  ++NF+AL  P+ HPARD  DTF++ E                                       + LLRTHT++V +R ++   E+   P K     +V+R +  D TH
Sbjct:   99 GRPVETGCHHPLTAVVEQIEDVFIGMGYE-VAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITE---------------------------------------ETLLRTHTSSVQARTMENNKEK--GPIKIICPGKVYRRDDDDATH 206          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BACC1 (Phenylalanyl-tRNA synthetase alpha chain OS=Bacillus cereus (strain ATCC 10987) GN=pheS PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.728e-12
Identity = 46/150 (30.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 GQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            G+P E G  HPL  V +Q++D+F+ MG+E +     VE  ++NF+AL  P+ HPARD  DTF++ E                                       + LLRTHT++V +R ++   E+   P K     +V+R +  D TH
Sbjct:   99 GRPVETGCHHPLTAVVEQIEDVFIGMGYE-VAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITE---------------------------------------ETLLRTHTSSVQARTMENNKEK--GPIKIICPGKVYRRDDDDATH 206          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BACC0 (Phenylalanyl-tRNA synthetase alpha chain OS=Bacillus cereus (strain AH820) GN=pheS PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.728e-12
Identity = 46/150 (30.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 GQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            G+P E G  HPL  V +Q++D+F+ MG+E +     VE  ++NF+AL  P+ HPARD  DTF++ E                                       + LLRTHT++V +R ++   E+   P K     +V+R +  D TH
Sbjct:   99 GRPVETGCHHPLTAVVEQIEDVFIGMGYE-VAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITE---------------------------------------ETLLRTHTSSVQARTMENNKEK--GPIKIICPGKVYRRDDDDATH 206          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BACAN (Phenylalanyl-tRNA synthetase alpha chain OS=Bacillus anthracis GN=pheS PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.728e-12
Identity = 46/150 (30.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 GQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            G+P E G  HPL  V +Q++D+F+ MG+E +     VE  ++NF+AL  P+ HPARD  DTF++ E                                       + LLRTHT++V +R ++   E+   P K     +V+R +  D TH
Sbjct:   99 GRPVETGCHHPLTAVVEQIEDVFIGMGYE-VAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITE---------------------------------------ETLLRTHTSSVQARTMENNKEK--GPIKIICPGKVYRRDDDDATH 206          
The following BLAST results are available for this feature:
BLAST of FC920178 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 74
Match NameE-valueIdentityDescription
SYFA_BACCZ9.728e-1230.67Phenylalanyl-tRNA synthetase alpha chain OS=Bacill... [more]
SYFA_BACCR9.728e-1230.67Phenylalanyl-tRNA synthetase alpha chain OS=Bacill... [more]
SYFA_BACCQ9.728e-1230.67Phenylalanyl-tRNA synthetase alpha chain OS=Bacill... [more]
SYFA_BACC79.728e-1230.67Phenylalanyl-tRNA synthetase alpha chain OS=Bacill... [more]
SYFA_BACC49.728e-1230.67Phenylalanyl-tRNA synthetase alpha chain OS=Bacill... [more]
SYFA_BACC39.728e-1230.67Phenylalanyl-tRNA synthetase alpha chain OS=Bacill... [more]
SYFA_BACC29.728e-1230.67Phenylalanyl-tRNA synthetase alpha chain OS=Bacill... [more]
SYFA_BACC19.728e-1230.67Phenylalanyl-tRNA synthetase alpha chain OS=Bacill... [more]
SYFA_BACC09.728e-1230.67Phenylalanyl-tRNA synthetase alpha chain OS=Bacill... [more]
SYFA_BACAN9.728e-1230.67Phenylalanyl-tRNA synthetase alpha chain OS=Bacill... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A06EF RVDevelop1 Citrus clementina cDNA clone C32005A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920178 ID=FC920178|Name=FC920178|organism=Citrus clementina|type=EST|length=692bp
AAAAGTCAAAGATTTGCTTCTACCAGTACAAAATGGACATGCGCTTAGCA
AAGAGGAGATTAGCAGTCTCAAAGCACGGAAGCTTATTGTTCCCCAGACA
TGGAAGGGGTACTCAGTGAGAAAAGGTCCTAATTATGCTCCCAAAAGGAA
GAAAGCTGCTACAGATTTGACTCGAGAGAACCTTCAGAAGGGTGATTGGA
AGGAATTGGAGTTCAAAGAGTACAACTTCAATGCTAAAGGACAGCCTGCG
GAAGGTGGCCATCTTCACCCACTGCTCAAGGTGCGGAAGCAATTGAAGGA
CATATTTCTCCAGATGGGTTTTGAGGAGATGCCGACAAACAATTTTGTTG
AAAGCAGCTTCTGGAACTTTGATGCATTATTCCAGCCACAACAACACCCT
GCCCGTGATTCTCATGATACCTTCTTTCTGGAAGAACCTTCCACTACAAG
GGAACTACCAGAAGATTATGTTGAGCGGGTGAAGCGTGTGCACGAGTCTG
GTGGTTATGGGTCCAGAGGATATGGATATGAGTGGAAAAGAGAGGAAGCA
AACAAAAACCTTCTGCGAACTCATACAACTGCTGTCTCTTCCAGGATGCT
TAAGGCACTAGCTGAAGAACCTTTTGCCCCGAAAAAGTATTTCTCCATAG
ATCGTGTTTTCAGAAATGAAGCTGTTGATCGAACTCATCTTG
back to top