FC920178

Overview
NameFC920178
Unique NameFC920178
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length692
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BACAC (Phenylalanyl-tRNA synthetase alpha chain OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pheS PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.728e-12
Identity = 46/150 (30.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 GQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            G+P E G  HPL  V +Q++D+F+ MG+E +     VE  ++NF+AL  P+ HPARD  DTF++ E                                       + LLRTHT++V +R ++   E+   P K     +V+R +  D TH
Sbjct:   99 GRPVETGCHHPLTAVVEQIEDVFIGMGYE-VAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITE---------------------------------------ETLLRTHTSSVQARTMENNKEK--GPIKIICPGKVYRRDDDDATH 206          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_BACAA (Phenylalanyl-tRNA synthetase alpha chain OS=Bacillus anthracis (strain A0248) GN=pheS PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.728e-12
Identity = 46/150 (30.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  239 GQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            G+P E G  HPL  V +Q++D+F+ MG+E +     VE  ++NF+AL  P+ HPARD  DTF++ E                                       + LLRTHT++V +R ++   E+   P K     +V+R +  D TH
Sbjct:   99 GRPVETGCHHPLTAVVEQIEDVFIGMGYE-VAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITE---------------------------------------ETLLRTHTSSVQARTMENNKEK--GPIKIICPGKVYRRDDDDATH 206          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_RHOS4 (Phenylalanyl-tRNA synthetase alpha chain OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pheS PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 8.235e-11
Identity = 51/181 (28.18%), Postives = 80/181 (44.20%), Query Frame = 2
Query:  146 RKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            RK+   D   +   K +W ++          G+P   G +HP+ +V  +L  IF  MGF  +     VES ++NFDAL  P +HPAR  HDTFF+                                   + ++   ++LRTHT+ V  R ++A      AP +  +  RV+R + +D+TH
Sbjct:   74 RKQGLADAALDARLKTEWLDVTLP-------GRPRRAGTIHPVSQVMAELTAIFADMGFA-VAEGPQVESDWFNFDALNIPPEHPARQEHDTFFMARA--------------------------------EGDDRPPHVLRTHTSPVQIRAMQAQG----APIRVIAPGRVYRMD-MDQTH 209          
BLAST of FC920178 vs. ExPASy Swiss-Prot
Match: SYFA_RHOS1 (Phenylalanyl-tRNA synthetase alpha chain OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=pheS PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 8.235e-11
Identity = 51/181 (28.18%), Postives = 80/181 (44.20%), Query Frame = 2
Query:  146 RKKAATDLTRENLQKGDWKELEFKEYNFNAKGQPAEGGHLHPLLKVRKQLKDIFLQMGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLEEPSTTRELPEDYVERVKRVHEXXXXXXXXXXXEWKREEANKNLLRTHTTAVSSRMLKALAEEPFAPKKYFSIDRVFRNEAVDRTH 688
            RK+   D   +   K +W ++          G+P   G +HP+ +V  +L  IF  MGF  +     VES ++NFDAL  P +HPAR  HDTFF+                                   + ++   ++LRTHT+ V  R ++A      AP +  +  RV+R + +D+TH
Sbjct:   74 RKQGLADAALDARLKTEWLDVTLP-------GRPRRAGTIHPVSQVMAELTAIFADMGFA-VAEGPQVESDWFNFDALNIPPEHPARQEHDTFFMARA--------------------------------EGDDRPPHVLRTHTSPVQIRAMQAQG----APIRVIAPGRVYRMD-MDQTH 209          
The following BLAST results are available for this feature:
BLAST of FC920178 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 74
Match NameE-valueIdentityDescription
SYFA_BACAC9.728e-1230.67Phenylalanyl-tRNA synthetase alpha chain OS=Bacill... [more]
SYFA_BACAA9.728e-1230.67Phenylalanyl-tRNA synthetase alpha chain OS=Bacill... [more]
SYFA_RHOS48.235e-1128.18Phenylalanyl-tRNA synthetase alpha chain OS=Rhodob... [more]
SYFA_RHOS18.235e-1128.18Phenylalanyl-tRNA synthetase alpha chain OS=Rhodob... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A06EF RVDevelop1 Citrus clementina cDNA clone C32005A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920178 ID=FC920178|Name=FC920178|organism=Citrus clementina|type=EST|length=692bp
AAAAGTCAAAGATTTGCTTCTACCAGTACAAAATGGACATGCGCTTAGCA
AAGAGGAGATTAGCAGTCTCAAAGCACGGAAGCTTATTGTTCCCCAGACA
TGGAAGGGGTACTCAGTGAGAAAAGGTCCTAATTATGCTCCCAAAAGGAA
GAAAGCTGCTACAGATTTGACTCGAGAGAACCTTCAGAAGGGTGATTGGA
AGGAATTGGAGTTCAAAGAGTACAACTTCAATGCTAAAGGACAGCCTGCG
GAAGGTGGCCATCTTCACCCACTGCTCAAGGTGCGGAAGCAATTGAAGGA
CATATTTCTCCAGATGGGTTTTGAGGAGATGCCGACAAACAATTTTGTTG
AAAGCAGCTTCTGGAACTTTGATGCATTATTCCAGCCACAACAACACCCT
GCCCGTGATTCTCATGATACCTTCTTTCTGGAAGAACCTTCCACTACAAG
GGAACTACCAGAAGATTATGTTGAGCGGGTGAAGCGTGTGCACGAGTCTG
GTGGTTATGGGTCCAGAGGATATGGATATGAGTGGAAAAGAGAGGAAGCA
AACAAAAACCTTCTGCGAACTCATACAACTGCTGTCTCTTCCAGGATGCT
TAAGGCACTAGCTGAAGAACCTTTTGCCCCGAAAAAGTATTTCTCCATAG
ATCGTGTTTTCAGAAATGAAGCTGTTGATCGAACTCATCTTG
back to top