FC920180

Overview
NameFC920180
Unique NameFC920180
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length642
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10294 contig Ccv1_Contig10294:8..649. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI1_SOLTU (Endochitinase 1 (Fragment) OS=Solanum tuberosum GN=CHTB1 PE=2 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 5.057e-49
Identity = 100/188 (53.19%), Postives = 121/188 (64.36%), Query Frame = 2
Query:   98 SAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDG-CQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARC-FYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR--GKYYGRGPIQLTWKLHY 634
            SA  CGS   G +C  G CCS+FGWCG T D+C  G CQS C            G  G  G+LG +IS  MF+ +L +RND  C  +  FY+Y+AFI AA +FP FG +G+ T RKREIAAFFAQT HETTGGWP AP G YAWGYCF RE G +  DYC P+  +PC    KY+GRGPIQ++   +Y
Sbjct:   17 SAEQCGSQAGGALCASGLCCSKFGWCGDTNDYCGPGNCQSQC-----------PGGPGPSGDLGGVISNSMFDQMLNHRNDNACQGKGNFYSYNAFISAAGSFPGFGTTGDITARKREIAAFFAQTSHETTGGWPTAPDGPYAWGYCFLREQG-SPGDYCTPSSQWPCAPGRKYFGRGPIQISHNYNY 192          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI4_SOLTU (Endochitinase 4 (Fragment) OS=Solanum tuberosum GN=CHTB4 PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.471e-48
Identity = 98/188 (52.13%), Postives = 121/188 (64.36%), Query Frame = 2
Query:   98 SAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDG-CQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARC-FYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR--GKYYGRGPIQLTWKLHY 634
            SA  CG    G  C  G CCS FGWCG T D+C  G CQS C      +  P  G    GG++G +IS  MF+ +L++RND  C  +  FY+Y+AFI AA++F  FG +G+ T RKREIAAFFAQT HETTGGWP AP G YAWGYCF RE G +  DYC P+  +PC    KY+GRGPIQ++   +Y
Sbjct:   17 SAEQCGKQAGGARCAAGLCCSNFGWCGNTNDYCGPGKCQSQCPSGPSPK-PPTPGPGPSGGDIGSVISNSMFDQMLKHRNDNACQGKNNFYSYNAFINAARSFGGFGTTGDTTARKREIAAFFAQTSHETTGGWPTAPDGPYAWGYCFLREQG-SPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNY 202          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI1_HORVU (26 kDa endochitinase 1 OS=Hordeum vulgare PE=2 SV=4)

HSP 1 Score: 192.2 bits (487), Expect = 1.922e-48
Identity = 100/185 (54.05%), Postives = 120/185 (64.86%), Query Frame = 2
Query:  101 AGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR-GK-YYGRGPIQLTWKLHY 634
            A  CGS   G  CP   CCSRFGWCG T  +C DGCQS C+    G   P   T   GG +  I+SR +F+ +L +RND  C A+ FYTYDAF+ AA AF  FG +G    RKRE+AAF AQT HETTGGW  AP G +AWGYCF +E G A+S+YC P+  +PC  GK YYGRGPIQL+   +Y
Sbjct:   19 AEQCGSQAGGATCPNCLCCSRFGWCGST-PYCGDGCQSQCSGCGGGST-PVTPTPSGGGGVSSIVSRALFDRMLLHRNDGACQAKGFYTYDAFVAAASAFRGFGTTGGTDTRKREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERG-ATSNYCTPSAQWPCAPGKSYYGRGPIQLSHNYNY 200          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI3_SOLTU (Endochitinase 3 (Fragment) OS=Solanum tuberosum GN=CHTB3 PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 2.510e-48
Identity = 99/188 (52.66%), Postives = 120/188 (63.83%), Query Frame = 2
Query:   98 SAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDG-CQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARC-FYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR--GKYYGRGPIQLTWKLHY 634
            SA  CGS   G +C  G CCS+FGWCG T D+C  G CQS C            G  G  G+LG +IS  MF+ +L +RND  C  +  FY+Y+AFI AA +FP FG +G+ T RKREIAAF AQT HETTGGWP AP G YAWGYCF RE G +  DYC P+  +PC    KY+GRGPIQ++   +Y
Sbjct:   17 SAEQCGSQAGGALCAPGLCCSKFGWCGNTNDYCGPGNCQSQC-----------PGGPGPSGDLGGVISNSMFDQMLNHRNDNACQGKNNFYSYNAFISAAGSFPGFGTTGDITARKREIAAFLAQTSHETTGGWPSAPDGPYAWGYCFLREQG-SPGDYCTPSSQWPCAPGRKYFGRGPIQISHNYNY 192          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIC_SOLLC (Basic 30 kDa endochitinase OS=Solanum lycopersicum GN=CHI9 PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 9.537e-48
Identity = 97/188 (51.60%), Postives = 120/188 (63.83%), Query Frame = 2
Query:   98 SAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDG-CQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARC-FYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR--GKYYGRGPIQLTWKLHY 634
            SA  CGS   G +C  G CCS+FGWCG T ++C  G CQS C            G  G  G+LG +IS  MF+ +L +RND  C  +  FY+Y+AF+ AA +FP FG +G+ T RKREIAAF AQT HETTGGWP AP G YAWGYCF RE G +  DYC P+  +PC    KY+GRGPIQ++   +Y
Sbjct:   21 SAEQCGSQAGGALCASGLCCSKFGWCGNTNEYCGPGNCQSQC-----------PGGPGPSGDLGGVISNSMFDQMLNHRNDNACQGKNNFYSYNAFVTAAGSFPGFGTTGDITARKREIAAFLAQTSHETTGGWPTAPDGPYAWGYCFLREQG-SPGDYCTPSSQWPCAPGRKYFGRGPIQISHNYNY 196          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI3_TOBAC (Endochitinase 3 OS=Nicotiana tabacum GN=CHN14 PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 9.537e-48
Identity = 97/188 (51.60%), Postives = 117/188 (62.23%), Query Frame = 2
Query:   98 SAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDG-CQSNCNQVVCGECDPDDGTAGDG-GELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYC--DPNYPCR--GKYYGRGPIQLTWKLHY 634
            SA  CG    G  CP G CCS FGWCG T D+C  G CQS C         P   T G   G++  IIS  MF+ +L++RND  C  + FYTY+AFI AA++F  FG +G+ T RKRE+AAFFAQT HETTGGW  AP G YAWGYC+ RE G   S YC     +PC    KYYGRGPIQ+++  +Y
Sbjct:   22 SAEQCGKQAGGARCPSGMCCSNFGWCGNTQDYCGPGKCQSQCPSGPGPTPRPPTPTPGPSTGDISNIISSSMFDQMLKHRNDNTCQGKSFYTYNAFITAARSFRGFGTTGDTTRRKREVAAFFAQTSHETTGGWDTAPDGRYAWGYCYLREQGNPPS-YCVQSSQWPCAPGQKYYGRGPIQISYNYNY 208          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI2_SOLTU (Endochitinase 2 (Fragment) OS=Solanum tuberosum GN=CHTB2 PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.246e-47
Identity = 98/188 (52.13%), Postives = 119/188 (63.30%), Query Frame = 2
Query:   98 SAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDG-CQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARC-FYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR--GKYYGRGPIQLTWKLHY 634
            SA  CGS   G +C  G CCS+FGWCG T D+C  G CQS C               G  G+LG +IS  MF+ +L +RND  C  +  FY+Y+AFI AA +FP FG +G+ T RKREIAAFFAQT HETTGGW  AP G YAWGYCF RE G +  DYC P+  +PC    KY+GRGPIQ++   +Y
Sbjct:   17 SAEQCGSQAGGALCASGLCCSKFGWCGNTNDYCGPGNCQSQC-------------PGGSPGDLGGVISNSMFDQMLNHRNDNACQGKGNFYSYNAFISAAGSFPGFGTTGDITARKREIAAFFAQTSHETTGGWASAPDGPYAWGYCFLREQG-SPGDYCTPSNQWPCAPGRKYFGRGPIQISHNYNY 190          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIB_POPTR (Acidic endochitinase WIN6.2B OS=Populus trichocarpa PE=2 SV=2)

HSP 1 Score: 176.022 bits (445), Expect = 1.425e-43
Identity = 87/162 (53.70%), Postives = 100/162 (61.73%), Query Frame = 2
Query:   95 GSAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGE----LGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYC-FNREVGAASSD 556
            GSA  CG      +CPGG CCS +GWCG T D+C DGCQS C+    G      G  G GG     L  II   MF+D+L+YRND +CPA  FYTY+AFI AAK FP FGN+G++ MRKREIAAF  QT HET G WP A G +Y WGYC  N   G    D
Sbjct:   19 GSAEQCGQQAGDALCPGGLCCSSYGWCGTTADYCGDGCQSQCDGGGGGGGGGGGGGGGGGGGGDGYLSDIIPESMFDDMLKYRNDPQCPAVGFYTYNAFISAAKEFPDFGNTGDDLMRKREIAAFLGQTSHETNGWWPAAQGDQYDWGYCHMNYNYGLCGDD 180          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIT_CARPA (Endochitinase OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.631e-39
Identity = 76/123 (61.79%), Postives = 94/123 (76.42%), Query Frame = 2
Query:  278 KIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYC--DPNYPCR-GK-YYGRGPIQLTWKLHY 634
            KIISR MF+ +L++RN+  CPA+ FYTYDAF+ AAK+FP+FG +G+  +RKRE+AAF  QT HETTGGWP AP G YAWGYCF +E    SS+YC   P YPC  GK YYGRGP+QL+W  +Y
Sbjct:    4 KIISRSMFDQMLKHRNNPACPAKGFYTYDAFLAAAKSFPSFGTTGSTDVRKRELAAFLGQTSHETTGGWPSAPDGPYAWGYCFLKERN-PSSNYCAPSPRYPCAPGKSYYGRGPLQLSWNYNY 125          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI7_ORYSJ (Chitinase 7 OS=Oryza sativa subsp. japonica GN=Cht7 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.130e-39
Identity = 88/188 (46.81%), Postives = 114/188 (60.64%), Query Frame = 2
Query:  104 GNCGSGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDG-----TAGDGGELG--KIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCR-GK-YYGRGPIQLTWKLHY 634
            G    G  CP   CCSR+GWCGLT D+C  GCQS C   V  +   DD      TA  GG  G   +++ + FE +L +R+D  CPAR FY Y AF+ AA AFPAF  +G+   RKRE+AAF AQT H T+       GG Y+WGYC+ +EV  A+SD+C PN  +PC  GK Y+ RGP+Q+ +  +Y
Sbjct:   36 GRQAGGARCPNRLCCSRWGWCGLTDDYCKGGCQSQCR--VSRDGGDDDVAAVLLTAPGGGRAGVASVVTSDQFERMLPHRDDAACPARGFYAYRAFVAAAGAFPAFAATGDADTRKREVAAFLAQTSHATS-------GGPYSWGYCY-KEVKGATSDFCVPNARWPCAPGKAYHARGPMQIAYNYNY 213          
The following BLAST results are available for this feature:
BLAST of FC920180 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHI1_SOLTU5.057e-4953.19Endochitinase 1 (Fragment) OS=Solanum tuberosum GN... [more]
CHI4_SOLTU1.471e-4852.13Endochitinase 4 (Fragment) OS=Solanum tuberosum GN... [more]
CHI1_HORVU1.922e-4854.0526 kDa endochitinase 1 OS=Hordeum vulgare PE=2 SV=... [more]
CHI3_SOLTU2.510e-4852.66Endochitinase 3 (Fragment) OS=Solanum tuberosum GN... [more]
CHIC_SOLLC9.537e-4851.60Basic 30 kDa endochitinase OS=Solanum lycopersicum... [more]
CHI3_TOBAC9.537e-4851.60Endochitinase 3 OS=Nicotiana tabacum GN=CHN14 PE=3... [more]
CHI2_SOLTU1.246e-4752.13Endochitinase 2 (Fragment) OS=Solanum tuberosum GN... [more]
CHIB_POPTR1.425e-4353.70Acidic endochitinase WIN6.2B OS=Populus trichocarp... [more]
CHIT_CARPA1.631e-3961.79Endochitinase OS=Carica papaya PE=1 SV=1[more]
CHI7_ORYSJ2.130e-3946.81Chitinase 7 OS=Oryza sativa subsp. japonica GN=Cht... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A08EF RVDevelop1 Citrus clementina cDNA clone C32005A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920180 ID=FC920180|Name=FC920180|organism=Citrus clementina|type=EST|length=642bp
AGCAGAGGATAATTGATCTCATAACTGTTGCTTTCAAATGAGGCTTATTG
CGTCCTTACTAATTTTCTCTCTGGTTTTATCTTTTGTACTAGGAGGCTCA
GCAGGGAACTGTGGAAGCGGCGTTGTGTGCCCAGGAGGGGAGTGTTGTAG
TCGATTTGGTTGGTGTGGCCTAACAATAGACCACTGTTGTGACGGCTGCC
AAAGTAACTGTAATCAGGTTGTTTGCGGTGAATGTGATCCCGACGACGGG
ACGGCTGGTGATGGCGGTGAACTGGGCAAGATCATCTCAAGGGAGATGTT
TGAAGACTTGCTTGAGTATAGAAATGATAAACGATGCCCTGCCAGATGCT
TCTACACTTATGATGCTTTTATAGAGGCAGCCAAAGCTTTTCCAGCCTTT
GGTAACTCTGGAAATGAAACCATGCGTAAAAGAGAAATTGCTGCCTTTTT
TGCCCAAACTGGCCATGAAACTACTGGGGGATGGCCCGATGCACCTGGTG
GCGAATATGCTTGGGGATATTGCTTTAATAGGGAAGTTGGCGCTGCGTCG
TCCGACTACTGTGATCCTAACTATCCATGTCGAGGGAAGTACTATGGCCG
AGGTCCAATTCAACTCACTTGGAAATTACATTACTTACGGTG
back to top