FC920180

Overview
NameFC920180
Unique NameFC920180
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length642
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10294 contig Ccv1_Contig10294:8..649. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIT_PETHY (Acidic endochitinase OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.870e-27
Identity = 63/121 (52.07%), Postives = 80/121 (66.12%), Query Frame = 2
Query:  272 LGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCRGKYYGRGPIQLTWKLHY 634
            +G I++ ++F+ +L+ RND RC A  FYTYDAFI AA +FP FG +G++T RK+EIAAFF QT HETTGG   +P G YA GYCF RE     +            YYGRGPIQLT + +Y
Sbjct:   26 VGSIVTSDLFDQMLKNRNDARCFAVRFYTYDAFIAAANSFPGFGTTGDDTARKKEIAAFFGQTSHETTGG-TLSPDGPYAGGYCFLREGNQMGNG-----------YYGRGPIQLTGQSNY 134          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIP_TOBAC (Acidic endochitinase P OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 7.106e-27
Identity = 62/121 (51.24%), Postives = 81/121 (66.94%), Query Frame = 2
Query:  272 LGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCRGKYYGRGPIQLTWKLHY 634
            +G I++ ++F ++L+ RND RCPA  FYTYDAFI AA +FP FG SG++T R++EIAAFF QT HETTGG   A    +  GYCF R+     +D  D       +YYGRGPIQLT + +Y
Sbjct:   27 IGSIVTNDLFNEMLKNRNDGRCPANGFYTYDAFIAAANSFPGFGTSGDDTARRKEIAAFFGQTSHETTGGSLSAE--PFTGGYCFVRQ-----NDQSD-------RYYGRGPIQLTNQNNY 133          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIB_MAIZE (Endochitinase B (Fragment) OS=Zea mays PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 7.106e-27
Identity = 66/184 (35.87%), Postives = 94/184 (51.09%), Query Frame = 2
Query:   98 SAGNCGSGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDP---NYPCRG--KYYGRGPIQLTWKLHY 634
            +A NCG    C    CCS+FG+CG T ++C DGCQS      C       G+ G G  +  +++   F  + + +    C  + FYT  AF+ A K +P F + G++   KREIAAFFA   HET               +C+  E+   S+ YCDP    +PC    KYYGRGP+Q++W  +Y
Sbjct:   19 AAQNCG----CQPNVCCSKFGYCGTTDEYCGDGCQSG----PCRSGRGGGGSGGGGANVASVVTSSFFNGI-KNQAGSGCEGKNFYTRSAFLSAVKGYPGFAHGGSQVQGKREIAAFFAHATHET-------------GHFCYISEIN-KSNAYCDPTKRQWPCAAGQKYYGRGPLQISWNYNY 179          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIQ_TOBAC (Acidic endochitinase Q OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.583e-26
Identity = 61/121 (50.41%), Postives = 81/121 (66.94%), Query Frame = 2
Query:  272 LGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCRGKYYGRGPIQLTWKLHY 634
            +G I++ ++F ++L+ RND RCPA  FYTYDAFI AA +FP FG +G++T R++EIAAFF QT HETTGG   A    +  GYCF R+     +D  D       +YYGRGPIQLT + +Y
Sbjct:   27 IGSIVTSDLFNEMLKNRNDGRCPANGFYTYDAFIAAANSFPGFGTTGDDTARRKEIAAFFGQTSHETTGGSLSAE--PFTGGYCFVRQ-----NDQSD-------RYYGRGPIQLTNRNNY 133          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI8_ORYSJ (Chitinase 8 OS=Oryza sativa subsp. japonica GN=Cht8 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 2.700e-26
Identity = 62/130 (47.69%), Postives = 81/130 (62.31%), Query Frame = 2
Query:  248 GTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNET-MRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCRGKYYGRGPIQLTWKLHY 634
            G A  G  +G +I++ +F  +L  R++ +CPAR FYTYDAFI AA +FPAFG SG    + +RE+AAFF QT HETTGG       ++ WGYCF  E+  A+S            YYGRGPIQLT + +Y
Sbjct:   26 GAAAQG--VGSVITQAVFNSMLPNRDNSQCPARGFYTYDAFIAAANSFPAFGTSGGSAELIRRELAAFFGQTSHETTGG-TRGSSDQFQWGYCFKEEINKATSP----------PYYGRGPIQLTGQSNY 142          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI6_ORYSJ (Chitinase 6 OS=Oryza sativa subsp. japonica GN=Cht6 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 7.856e-26
Identity = 68/184 (36.96%), Postives = 97/184 (52.72%), Query Frame = 2
Query:   98 SAGNCGSGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCD---PNYPC-RGK-YYGRGPIQLTWKLHY 634
            +A +CG    C   +CCS++G+CG   D+C  GCQ+           P D  A +   +  I++ E F  L+   +D  C A+ FYT DAF+ AA  +P+FG +G+    KREIAAFFA   HET               +C+  E+   S +YCD     +PC  GK YYGRGP+Q++W  +Y
Sbjct:   24 AAQSCG----CASDQCCSKWGFCGTGSDYCGTGCQAG----------PCDVPATNDVSVASIVTPEFFAALVAQADDG-CAAKGFYTRDAFLTAAGGYPSFGRTGSVDDSKREIAAFFAHANHETI-------------KFCYIEEIDGPSKNYCDETSTQWPCMAGKGYYGRGPLQISWNFNY 179          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI4_BRANA (Basic endochitinase CHB4 OS=Brassica napus PE=1 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 1.750e-25
Identity = 72/183 (39.34%), Postives = 92/183 (50.27%), Query Frame = 2
Query:  107 NCGSGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGD--GGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN---YPCR-GK-YYGRGPIQLTWKLHY 634
            NCG    C    CCS+FG+CG T  +C  GC+S       G C    GT     GG +G I+++  F  ++       C  + FYT D+FI AA  FP F NS    + +REIA  FA   HET               +C+  E+  AS DYCD N   YPC  GK Y+GRGPIQL+W  +Y
Sbjct:   26 NCG----CAPNLCCSQFGYCGSTDAYCGTGCRS-------GPCRSPGGTPSPPGGGSVGSIVTQAFFNGIINQAGGG-CAGKNFYTRDSFINAANTFPNFANS----VTRREIATMFAHFTHET-------------GHFCYIEEINGASRDYCDENNRQYPCAPGKGYFGRGPIQLSWNYNY 179          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIA_MAIZE (Endochitinase A OS=Zea mays PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 5.092e-25
Identity = 68/185 (36.76%), Postives = 92/185 (49.73%), Query Frame = 2
Query:   98 SAGNCGSGVVCPGGECCSRFGWCGLTIDHCCDGCQSN-CNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN---YPCRG--KYYGRGPIQLTWKLHY 634
            +A NCG    C    CCS+FG+CG T  +C DGCQS  C     G      G  G GG     +  + F + ++ +    C  + FYT  AF+ A  A+P F + G E   KREIAAFFA   HET               +C+  E+   S+ YCD +   +PC    KYYGRGP+Q++W  +Y
Sbjct:   24 AAQNCG----CQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGGGGSGGANVANVVTDAFFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHET-------------GHFCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNY 190          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: AGI_URTDI (Lectin/endochitinase 1 OS=Urtica dioica GN=UDA1 PE=1 SV=3)

HSP 1 Score: 114.005 bits (284), Expect = 6.651e-25
Identity = 65/182 (35.71%), Postives = 92/182 (50.55%), Query Frame = 2
Query:  110 CGSGV---VCPGGECCSRFGWCGLTIDHCCDG-CQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYC-DPNYPCRG--KYYGRGPIQLTWKLHY 634
            CG+ V    C    CCS  GWCG   D+C    CQ  C+  V G      G +        +++  +F+ +  +R D  CP++ FY+Y +F+ AA++FPAFG  G+   RKRE+AAF A     T+G   D     +AWG C         +D+C   ++PC    KY  RGPIQLT   +Y
Sbjct:   72 CGAAVGNPPCGQDRCCSVHGWCGGGNDYCSGSKCQYRCSSSVRGPRVALSGNSTANSIGNVVVTEPLFDQMFSHRKD--CPSQGFYSYHSFLVAAESFPAFGTIGDVATRKREVAAFLAHISQATSGERSDVE-NPHAWGLCHINTTTVTENDFCTSSDWPCAAGKKYSPRGPIQLTHNFNY 250          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI5_ORYSJ (Chitinase 5 OS=Oryza sativa subsp. japonica GN=Cht5 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 3.301e-24
Identity = 68/188 (36.17%), Postives = 92/188 (48.94%), Query Frame = 2
Query:   98 SAGNCGSGVVCPGGECCSRFGWCGLTIDHCCDGCQSN-CNQVVCGECDPDDGTAGDGGELG---KIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN---YPCR--GKYYGRGPIQLTWKLHY 634
            SA NCG    C    CCS++G+CG   D+C DGC+S  C     G      G  G GG  G   + +  E F + ++ +    C  + FYT  +F+ AA ++  F         KREIAAFFA   HET                C+  E+  AS DYCD N   +PC+   KYYGRGP+Q++W  +Y
Sbjct:   28 SAQNCG----CQSNMCCSKWGYCGTGKDYCGDGCRSGPCYGGGGGGGGGGGGGGGGGGGSGVSVESVVTEAFFNGIKNQAPNGCAGKNFYTRQSFLNAAHSYSGFARDRTNDDSKREIAAFFAHVTHET-------------GHMCYINEINGASMDYCDKNNKQWPCQPGKKYYGRGPLQISWNYNY 198          
The following BLAST results are available for this feature:
BLAST of FC920180 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHIT_PETHY1.870e-2752.07Acidic endochitinase OS=Petunia hybrida PE=2 SV=1[more]
CHIP_TOBAC7.106e-2751.24Acidic endochitinase P OS=Nicotiana tabacum PE=1 S... [more]
CHIB_MAIZE7.106e-2735.87Endochitinase B (Fragment) OS=Zea mays PE=1 SV=1[more]
CHIQ_TOBAC1.583e-2650.41Acidic endochitinase Q OS=Nicotiana tabacum PE=1 S... [more]
CHI8_ORYSJ2.700e-2647.69Chitinase 8 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI6_ORYSJ7.856e-2636.96Chitinase 6 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI4_BRANA1.750e-2539.34Basic endochitinase CHB4 OS=Brassica napus PE=1 SV... [more]
CHIA_MAIZE5.092e-2536.76Endochitinase A OS=Zea mays PE=1 SV=1[more]
AGI_URTDI6.651e-2535.71Lectin/endochitinase 1 OS=Urtica dioica GN=UDA1 PE... [more]
CHI5_ORYSJ3.301e-2436.17Chitinase 5 OS=Oryza sativa subsp. japonica GN=Cht... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A08EF RVDevelop1 Citrus clementina cDNA clone C32005A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920180 ID=FC920180|Name=FC920180|organism=Citrus clementina|type=EST|length=642bp
AGCAGAGGATAATTGATCTCATAACTGTTGCTTTCAAATGAGGCTTATTG
CGTCCTTACTAATTTTCTCTCTGGTTTTATCTTTTGTACTAGGAGGCTCA
GCAGGGAACTGTGGAAGCGGCGTTGTGTGCCCAGGAGGGGAGTGTTGTAG
TCGATTTGGTTGGTGTGGCCTAACAATAGACCACTGTTGTGACGGCTGCC
AAAGTAACTGTAATCAGGTTGTTTGCGGTGAATGTGATCCCGACGACGGG
ACGGCTGGTGATGGCGGTGAACTGGGCAAGATCATCTCAAGGGAGATGTT
TGAAGACTTGCTTGAGTATAGAAATGATAAACGATGCCCTGCCAGATGCT
TCTACACTTATGATGCTTTTATAGAGGCAGCCAAAGCTTTTCCAGCCTTT
GGTAACTCTGGAAATGAAACCATGCGTAAAAGAGAAATTGCTGCCTTTTT
TGCCCAAACTGGCCATGAAACTACTGGGGGATGGCCCGATGCACCTGGTG
GCGAATATGCTTGGGGATATTGCTTTAATAGGGAAGTTGGCGCTGCGTCG
TCCGACTACTGTGATCCTAACTATCCATGTCGAGGGAAGTACTATGGCCG
AGGTCCAATTCAACTCACTTGGAAATTACATTACTTACGGTG
back to top