FC920180

Overview
NameFC920180
Unique NameFC920180
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length642
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10294 contig Ccv1_Contig10294:8..649. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIC_POPTR (Acidic endochitinase WIN6.2C (Fragment) OS=Populus trichocarpa PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 7.353e-24
Identity = 57/105 (54.29%), Postives = 67/105 (63.81%), Query Frame = 2
Query:   95 GSAGNCG---SGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGE-CDPDDGTAGDG--GELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAF 391
            GSA  CG      +CPGG CCS +GWCG T+D+C DGCQS C+    G+ CD   G  GDG  G L  II +  F+ LL++RND RC A  FYTYDAFI AAK F
Sbjct:   20 GSAEQCGRQAGDALCPGGLCCSFYGWCGTTVDYCGDGCQSQCDG---GDGCDGGGGGGGDGDDGYLSDIIPKSTFDALLKFRNDPRCHAVGFYTYDAFISAAKEF 121          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI4_PHAVU (Endochitinase PR4 OS=Phaseolus vulgaris GN=CHI4 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 9.604e-24
Identity = 67/185 (36.22%), Postives = 90/185 (48.65%), Query Frame = 2
Query:   98 SAGNCGSGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCD----PNYPCRGK--YYGRGPIQLTWKLHY 634
            SA NCG    C  G CCS++G+CG   D+C  GCQ    Q  C    P      +      I++ +    +++ + D  C  + FYT DAF+ A  ++  FG  G+E   KREIAA FA   HET               +C+  E+  AS DYCD      YPC     Y+GRGPIQL+W  +Y
Sbjct:   22 SAQNCG----CAEGLCCSQYGYCGTGEDYCGTGCQ----QGPCTTASPPPSNNVNAD----ILTADFLNGIID-QADSGCAGKNFYTRDAFLSALNSYTDFGRVGSEDDSKREIAAAFAHFTHET-------------GHFCYIEEIDGASKDYCDEESIAQYPCSSSKGYHGRGPIQLSWNFNY 180          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHI4_ORYSJ (Chitinase 4 OS=Oryza sativa subsp. japonica GN=Cht4 PE=2 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 1.254e-23
Identity = 65/189 (34.39%), Postives = 94/189 (49.74%), Query Frame = 2
Query:   98 SAGNCGSGVVCPGGECCSRFGWCGLTIDHCCDGCQSN-C----NQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN---YPCR--GKYYGRGPIQLTWKLHY 634
            +A NCG    C  G CCS++G+CG T  +C  GCQS  C     +   G      G AG G  +  +++   F  + + +    C  + FYT  +F+ AA+++  F N       KREIAAFFA   HET                C+  E+  A+ DYCD +   +PC+   KYYGRGP+Q++W  +Y
Sbjct:   26 AAQNCG----CQDGYCCSQWGYCGTTEAYCGQGCQSGPCWGSGGEAAAGMAGRKAG-AGAGVSVESVVTEAFFNGI-KNQAPNGCAGKSFYTRQSFLNAARSYSGFANDRTNDDSKREIAAFFAHVTHET-------------GHMCYINEINGANMDYCDKSNKQWPCQPGKKYYGRGPLQISWNFNY 195          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIT_AVESA (Endochitinase (Fragments) OS=Avena sativa PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 8.989e-22
Identity = 55/121 (45.45%), Postives = 72/121 (59.50%), Query Frame = 2
Query:  272 LGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCRGKYYGRGPIQLTWKLHY 634
            +  +IS  +FE +L +R         FYTYDAFI AAK+FPAF  +G+  +RKRE+AAF AQT HETTGGWP AP G Y        E+G+ S             Y+GRGPIQ+++  +Y
Sbjct:    1 VSSVISSSLFEKMLLHRG--------FYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPY--------ELGSTSD------------YFGRGPIQISYNYNY 93          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIP_BETVU (Acidic endochitinase SP2 OS=Beta vulgaris GN=SP2 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 8.989e-22
Identity = 71/195 (36.41%), Postives = 87/195 (44.62%), Query Frame = 2
Query:  101 AGNCGSGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDD----------GTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNRE-VGAASSDYCDPN----YPCRG--KYYGRGPIQLTWKLHY 634
            A NCG    C    CCS FG+CG    +C  G   NC    C    P            GT G G  +  I+S+  F+ ++  +    CP + FYT  AF+ A    P FGN G+    KREIAAFFA   HETT               C   E  G     YCD +    YPC    KYYGRGP+QL+W  +Y
Sbjct:   27 AQNCG----CAPNLCCSNFGFCGTGTPYCGVG---NCQSGPCEGGTPTTPTTPTTPTTPGTGGGGSSVSDIVSQAFFDGIIG-QAAASCPGKNFYTRAAFLSAVD--PKFGNEGSSDDNKREIAAFFAHISHETT-------------NLCHIEERDGDVGDAYCDQDKAAQYPCAAGKKYYGRGPLQLSWNYNY 198          
BLAST of FC920180 vs. ExPASy Swiss-Prot
Match: CHIT_DIOJA (Acidic endochitinase OS=Dioscorea japonica PE=1 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 2.002e-21
Identity = 61/170 (35.88%), Postives = 86/170 (50.59%), Query Frame = 2
Query:  143 CCSRFGWCGLTIDHCCDGCQSNCNQVVCGEC-DPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPC--RGKYYGRGPIQLTWKLHYL 637
            CCS+ G+CG + D+C  GCQ+       G C DP +G   DG      I  + F D +  +    CP + FYT   F+EA  A+P FG    +  RKREIAA+FA   HET                C+  E    +++YC  +  YPC    +Y+GRGP+QL+W  +Y+
Sbjct:   11 CCSQHGYCGNSYDYCGPGCQA-------GPCWDPCEG---DGTLTVSDIVTQEFWDGIASQAAANCPGKSFYTRSNFLEAVSAYPGFGTKCTDEDRKREIAAYFAHVTHET-------------GHLCYIEERDGHANNYCQESQQYPCNPNKEYFGRGPMQLSWNYNYI 157          
The following BLAST results are available for this feature:
BLAST of FC920180 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHIC_POPTR7.353e-2454.29Acidic endochitinase WIN6.2C (Fragment) OS=Populus... [more]
CHI4_PHAVU9.604e-2436.22Endochitinase PR4 OS=Phaseolus vulgaris GN=CHI4 PE... [more]
CHI4_ORYSJ1.254e-2334.39Chitinase 4 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIT_AVESA8.989e-2245.45Endochitinase (Fragments) OS=Avena sativa PE=1 SV=... [more]
CHIP_BETVU8.989e-2236.41Acidic endochitinase SP2 OS=Beta vulgaris GN=SP2 P... [more]
CHIT_DIOJA2.002e-2135.88Acidic endochitinase OS=Dioscorea japonica PE=1 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A08EF RVDevelop1 Citrus clementina cDNA clone C32005A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920180 ID=FC920180|Name=FC920180|organism=Citrus clementina|type=EST|length=642bp
AGCAGAGGATAATTGATCTCATAACTGTTGCTTTCAAATGAGGCTTATTG
CGTCCTTACTAATTTTCTCTCTGGTTTTATCTTTTGTACTAGGAGGCTCA
GCAGGGAACTGTGGAAGCGGCGTTGTGTGCCCAGGAGGGGAGTGTTGTAG
TCGATTTGGTTGGTGTGGCCTAACAATAGACCACTGTTGTGACGGCTGCC
AAAGTAACTGTAATCAGGTTGTTTGCGGTGAATGTGATCCCGACGACGGG
ACGGCTGGTGATGGCGGTGAACTGGGCAAGATCATCTCAAGGGAGATGTT
TGAAGACTTGCTTGAGTATAGAAATGATAAACGATGCCCTGCCAGATGCT
TCTACACTTATGATGCTTTTATAGAGGCAGCCAAAGCTTTTCCAGCCTTT
GGTAACTCTGGAAATGAAACCATGCGTAAAAGAGAAATTGCTGCCTTTTT
TGCCCAAACTGGCCATGAAACTACTGGGGGATGGCCCGATGCACCTGGTG
GCGAATATGCTTGGGGATATTGCTTTAATAGGGAAGTTGGCGCTGCGTCG
TCCGACTACTGTGATCCTAACTATCCATGTCGAGGGAAGTACTATGGCCG
AGGTCCAATTCAACTCACTTGGAAATTACATTACTTACGGTG
back to top