FC920398

Overview
NameFC920398
Unique NameFC920398
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length663
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14268 contig Ccv1_Contig14268:4..666. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_SYNS9 (Phosphoglycerate kinase OS=Synechococcus sp. (strain CC9902) GN=pgk PE=3 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 9.700e-59
Identity = 120/186 (64.52%), Postives = 139/186 (74.73%), Query Frame = 3
Query:  105 AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAV 659
            AK+S++ L   DL GKRV VRVD NVPL+D   ITDD R+RAA+PTI  L+G GAKV+L++H GRPKG V     L P+  RLSELLG  V   + CIG + E  V  +  G V+LLENVRF  EEEKND  FA+KLA+LAD+YVNDAFG+AHRAHASTEGV KFLKPSVAGFLM KEL YL GAV
Sbjct:    2 AKRSLASLNAGDLSGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLVGKGAKVVLAAHFGRPKGQVNEAMRLTPVAARLSELLGKTVTKTDSCIGPDAEAKVGAMANGDVVLLENVRFVAEEEKNDSGFAEKLAALADVYVNDAFGAAHRAHASTEGVTKFLKPSVAGFLMEKELQYLQGAV 187          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_PROM9 (Phosphoglycerate kinase OS=Prochlorococcus marinus (strain MIT 9312) GN=pgk PE=3 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 9.700e-59
Identity = 116/186 (62.37%), Postives = 141/186 (75.81%), Query Frame = 3
Query:  105 AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAV 659
            +K S+S L + +L+GK+V VRVD NVPL+++  ITDD R+RAA+PTI+YL+ H AKVIL++H GRPKG V  K  L P+  RLSELLG  V + N CIG+E       +  G VLLLENVRF  EEEKND EFAKKLAS AD+YVNDAFG+AHRAHAST+GV  +L PSVAGFL+ KEL YL GA+
Sbjct:    2 SKLSLSSLDKTNLEGKKVLVRVDFNVPLNEDGQITDDTRIRAAIPTIEYLINHSAKVILAAHFGRPKGQVNEKMRLTPVAARLSELLGQNVALTNSCIGDEAVAQSNSLSNGDVLLLENVRFFGEEEKNDLEFAKKLASHADMYVNDAFGAAHRAHASTQGVTNYLSPSVAGFLLEKELKYLQGAI 187          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_CYAP7 (Phosphoglycerate kinase OS=Cyanothece sp. (strain PCC 7424) GN=pgk PE=3 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 9.700e-59
Identity = 116/185 (62.70%), Postives = 141/185 (76.22%), Query Frame = 3
Query:  108 KKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAV 659
            KK+++ L  AD++GKRV VRVD NVPLDD  NITDD R+RAA+PTI+ L+  GAKVIL SH GRPKG V     L P   RLSELLG +V M +DC+G  V + V ++  G V LLEN+RFH EEE NDPEF+K+LA+ ADLYVNDAFG+AHRAHASTEGV  +L PSVAG+L+ KEL+YL  A+
Sbjct:    3 KKTIANLSRADVEGKRVLVRVDFNVPLDDAGNITDDTRIRAALPTIQDLISKGAKVILCSHFGRPKGKVVESMRLTPTAKRLSELLGQDVVMCDDCVGASVTEAVNKLENGQVALLENLRFHAEEEGNDPEFSKQLAANADLYVNDAFGTAHRAHASTEGVTHYLSPSVAGYLIEKELNYLQSAI 187          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_SYNSC (Phosphoglycerate kinase OS=Synechococcus sp. (strain CC9605) GN=pgk PE=3 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.267e-58
Identity = 120/186 (64.52%), Postives = 138/186 (74.19%), Query Frame = 3
Query:  105 AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAV 659
            AK+S++ L   DL GKRV VRVD NVPL+D   ITDD R+RAA+PTI  L+G GAKVILS+H GRPKG V     L P+  RLSELLG  V   + CIG + E  V  +  G V+LLENVRF  EEEKN+  FA+KLA LA++YVNDAFG+AHRAHASTEGV KFLKPSVAGFLM KEL YL GAV
Sbjct:    2 AKRSLASLNAGDLSGKRVLVRVDFNVPLNDTGAITDDTRIRAALPTINDLIGKGAKVILSAHFGRPKGQVNDAMRLTPVAARLSELLGKPVAKTDSCIGPDAEAKVGAMANGDVVLLENVRFFAEEEKNEAGFAEKLAGLAEVYVNDAFGAAHRAHASTEGVTKFLKPSVAGFLMEKELQYLQGAV 187          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_SYNR3 (Phosphoglycerate kinase OS=Synechococcus sp. (strain RCC307) GN=pgk PE=3 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 2.161e-58
Identity = 119/186 (63.98%), Postives = 140/186 (75.27%), Query Frame = 3
Query:  105 AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAV 659
            AK+S+S L    L+GKRV VRVD NVPL+D   ITDD R+RAA+PTIK L G GAKVILS+H GRPKG V     L P+  RLSELLG  V   + CIG + E  VA + +G V+LLENVRF  EEEKN+  FA+KLA+LA++YVNDAFG+AHRAHASTEGV K+L PSVAG+LM KEL YL GAV
Sbjct:    2 AKRSLSALNSDALRGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTIKDLTGKGAKVILSAHFGRPKGQVNEDMRLTPVAARLSELLGAPVAKTDSCIGSDAEAKVAAMADGDVVLLENVRFFAEEEKNESGFAEKLAALAEVYVNDAFGAAHRAHASTEGVTKYLSPSVAGYLMEKELQYLQGAV 187          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_SYNPW (Phosphoglycerate kinase OS=Synechococcus sp. (strain WH7803) GN=pgk PE=3 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 2.822e-58
Identity = 119/186 (63.98%), Postives = 139/186 (74.73%), Query Frame = 3
Query:  105 AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAV 659
            AK+S++ L   DL GKRV VRVD NVPL+D   ITDD R+RAA+PTI  L+G GAKVILS+H GRPKG V     L P+  RLSELLG  V   + CIG + E  V  + +G V+LLENVRF  EEEKN+  FA+KLA LA++YVNDAFG+AHRAHASTEGV KFLKP+VAGFLM KEL YL GAV
Sbjct:    2 AKRSLASLNAGDLSGKRVLVRVDFNVPLNDAGAITDDTRIRAALPTINDLIGKGAKVILSAHFGRPKGQVNDAMRLTPVAARLSELLGKPVAKTDSCIGPDAEAKVGAMADGDVVLLENVRFFAEEEKNEAGFAEKLAGLAEVYVNDAFGAAHRAHASTEGVTKFLKPAVAGFLMEKELQYLQGAV 187          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_PROM5 (Phosphoglycerate kinase OS=Prochlorococcus marinus (strain MIT 9515) GN=pgk PE=3 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 2.822e-58
Identity = 114/186 (61.29%), Postives = 144/186 (77.42%), Query Frame = 3
Query:  105 AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAV 659
            +K S+S L ++ L+GK+V VRVD NVPL+D+  ITDD R+RAA+PTIKYL+ + AKVIL++H GRPKG V  +  L P+  RLSE+LG +V +   CIGEE  +    +  G VLLLENVRF++EEEKND  FAK LA+ AD+YVNDAFG+AHRAHAST+GV KFL+PSVAGFL+ KEL YL GA+
Sbjct:    2 SKLSLSSLDKSKLEGKKVLVRVDFNVPLNDDGQITDDTRIRAAIPTIKYLINNSAKVILAAHFGRPKGKVNERMRLTPIAARLSEILGKKVNLTESCIGEEALEKSNNLNNGDVLLLENVRFYEEEEKNDLNFAKNLAAHADMYVNDAFGAAHRAHASTQGVTKFLEPSVAGFLLEKELKYLQGAI 187          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_PROM2 (Phosphoglycerate kinase OS=Prochlorococcus marinus (strain MIT 9215) GN=pgk PE=3 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 2.822e-58
Identity = 115/186 (61.83%), Postives = 140/186 (75.27%), Query Frame = 3
Query:  105 AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAV 659
            +K S+S L +  L+GK+V VRVD NVPL+++  ITDD R+RAA+PTI+YL+ H AKVIL++H GRPKG V  K  L P+  RLSELLG  V + N CIG+E       +  G VLLLENVRF  EEEKND EFAKKLAS AD+Y+NDAFG+AHRAHAST+GV  +L PSVAGFL+ KEL YL GA+
Sbjct:    2 SKLSLSSLDKTHLEGKKVLVRVDFNVPLNEDGQITDDTRIRAAIPTIEYLINHSAKVILAAHFGRPKGQVNEKMRLTPVAARLSELLGQNVALTNSCIGDEAIAQSNSLSNGDVLLLENVRFFGEEEKNDLEFAKKLASHADMYINDAFGAAHRAHASTQGVTNYLSPSVAGFLLEKELKYLQGAI 187          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_PROMS (Phosphoglycerate kinase OS=Prochlorococcus marinus (strain AS9601) GN=pgk PE=3 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 3.686e-58
Identity = 116/186 (62.37%), Postives = 140/186 (75.27%), Query Frame = 3
Query:  105 AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAV 659
            +K S+S L +  L+GK+V VRVD NVPL+++  ITDD R+RAA+PTI+YL+ H AKVIL++H GRPKG V  K  L P+  RLSELLG  V + N CIG+E       +  G VLLLENVRF  EEEKND EFA+KLAS AD+YVNDAFG+AHRAHAST+GV  +L PSVAGFL+ KEL YL GAV
Sbjct:    2 SKLSLSSLDKTHLEGKKVLVRVDFNVPLNEDGQITDDTRIRAAIPTIEYLINHSAKVILAAHFGRPKGQVNEKMRLTPVAARLSELLGQNVALTNSCIGDEAVAQSNSLSNGDVLLLENVRFFGEEEKNDLEFAEKLASHADMYVNDAFGAAHRAHASTQGVTNYLSPSVAGFLLEKELKYLQGAV 187          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_SYNPX (Phosphoglycerate kinase OS=Synechococcus sp. (strain WH8102) GN=pgk PE=3 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 4.814e-58
Identity = 119/186 (63.98%), Postives = 139/186 (74.73%), Query Frame = 3
Query:  105 AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAV 659
            AK+S++ L   DL GKRV VRVD NVPL++   ITDD R+RAA+PTI  L+G GAKVILS+H GRPKG V     L P+  RLSELLG  V   + CIG + E  V  + +G V+LLENVRF  EEEKND  FA+KLA LA++YVNDAFG+AHRAHASTEGV KFLKP+VAGFLM KEL YL GAV
Sbjct:    2 AKRSLASLNAGDLSGKRVLVRVDFNVPLNEAGAITDDTRIRAALPTINDLIGKGAKVILSAHFGRPKGQVNDAMRLTPVAARLSELLGKPVAKTDSCIGPDAEAKVNAMADGDVVLLENVRFFAEEEKNDAGFAEKLAGLAEVYVNDAFGAAHRAHASTEGVTKFLKPAVAGFLMEKELQYLQGAV 187          
The following BLAST results are available for this feature:
BLAST of FC920398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
PGK_SYNS99.700e-5964.52Phosphoglycerate kinase OS=Synechococcus sp. (stra... [more]
PGK_PROM99.700e-5962.37Phosphoglycerate kinase OS=Prochlorococcus marinus... [more]
PGK_CYAP79.700e-5962.70Phosphoglycerate kinase OS=Cyanothece sp. (strain ... [more]
PGK_SYNSC1.267e-5864.52Phosphoglycerate kinase OS=Synechococcus sp. (stra... [more]
PGK_SYNR32.161e-5863.98Phosphoglycerate kinase OS=Synechococcus sp. (stra... [more]
PGK_SYNPW2.822e-5863.98Phosphoglycerate kinase OS=Synechococcus sp. (stra... [more]
PGK_PROM52.822e-5861.29Phosphoglycerate kinase OS=Prochlorococcus marinus... [more]
PGK_PROM22.822e-5861.83Phosphoglycerate kinase OS=Prochlorococcus marinus... [more]
PGK_PROMS3.686e-5862.37Phosphoglycerate kinase OS=Prochlorococcus marinus... [more]
PGK_SYNPX4.814e-5863.98Phosphoglycerate kinase OS=Synechococcus sp. (stra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007G09EF RVDevelop1 Citrus clementina cDNA clone C32007G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920398 ID=FC920398|Name=FC920398|organism=Citrus clementina|type=EST|length=663bp
GATTTTCTCACTTAGCGTTCACCAATCTTCGATCTCATTCCAAAATCTAA
CCAAAACCCCTTCTCGATTTCTCCGATCTCGTGTTTGATCGAATCAAAAT
GGCCGCCAAGAAGAGTGTAAGCGTTCTAAAAGAAGCTGATTTGAAGGGAA
AGAGAGTGTTCGTACGAGTGGATCTGAACGTGCCGTTGGATGACAACTTG
AATATCACCGATGACAACAGAGTCCGTGCTGCTGTTCCCACTATCAAATA
CCTGATGGGTCATGGCGCCAAAGTCATTCTCTCCAGTCACTTGGGGCGTC
CAAAGGGTGTTACACCCAAGTACAGCTTGAAACCTCTTGTGCCAAGGCTT
TCTGAACTTCTTGGAGTTGAGGTTAAAATGGCAAACGACTGCATTGGTGA
AGAAGTTGAAAAAATGGTGGCTGAAATTCCCGAAGGGGGCGTCTTGCTCC
TCGAAAATGTGAGGTTCCATAAGGAGGAAGAGAAGAATGACCCAGAGTTT
GCTAAGAAGCTAGCTTCTCTTGCAGATCTCTATGTTAATGATGCATTCGG
ATCTGCCCATAGAGCCCATGCTTCCACTGAGGGTGTGGCTAAGTTCTTGA
AGCCTTCTGTGGCTGGTTTCCTTATGNCAAAGGAACTAGATTATCTTGTT
GGAGCTGTTTCAA
back to top