FC920398

Overview
NameFC920398
Unique NameFC920398
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length663
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14268 contig Ccv1_Contig14268:4..666. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_SALTI (Phosphoglycerate kinase OS=Salmonella typhi GN=pgk PE=3 SV=2)

HSP 1 Score: 144.436 bits (363), Expect = 4.848e-34
Identity = 80/180 (44.44%), Postives = 117/180 (65.00%), Query Frame = 3
Query:  114 SVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG--VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYL 647
            SV  + + DL GKRVF+R DLNVP+ +   +T D R+RA++PTI+  +  GAKV+++SHLGRP       ++SL P+V  L + L   V++  D +         ++ EG +++LENVRF+K E+K+D   +KK A+L D++V DAFG+AHRA AST G+ KF   + AG L+  ELD L
Sbjct:    2 SVIKMTDLDLAGKRVFIRADLNVPVKEG-KVTSDARIRASLPTIELALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDG------VDVAEGELVVLENVRFNKGEKKDDEALSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDAL 174          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_SALSV (Phosphoglycerate kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=pgk PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.848e-34
Identity = 80/180 (44.44%), Postives = 117/180 (65.00%), Query Frame = 3
Query:  114 SVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG--VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYL 647
            SV  + + DL GKRVF+R DLNVP+ +   +T D R+RA++PTI+  +  GAKV+++SHLGRP       ++SL P+V  L + L   V++  D +         ++ EG +++LENVRF+K E+K+D   +KK A+L D++V DAFG+AHRA AST G+ KF   + AG L+  ELD L
Sbjct:    2 SVIKMTDLDLAGKRVFIRADLNVPVKEG-KVTSDARIRASLPTIELALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDG------VDVAEGELVVLENVRFNKGEKKDDEALSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDAL 174          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_SALPK (Phosphoglycerate kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=pgk PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.848e-34
Identity = 80/180 (44.44%), Postives = 117/180 (65.00%), Query Frame = 3
Query:  114 SVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG--VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYL 647
            SV  + + DL GKRVF+R DLNVP+ +   +T D R+RA++PTI+  +  GAKV+++SHLGRP       ++SL P+V  L + L   V++  D +         ++ EG +++LENVRF+K E+K+D   +KK A+L D++V DAFG+AHRA AST G+ KF   + AG L+  ELD L
Sbjct:    2 SVIKMTDLDLAGKRVFIRADLNVPVKEG-KVTSDARIRASLPTIELALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDG------VDVAEGELVVLENVRFNKGEKKDDEALSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDAL 174          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_SALPB (Phosphoglycerate kinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pgk PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.848e-34
Identity = 80/180 (44.44%), Postives = 117/180 (65.00%), Query Frame = 3
Query:  114 SVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG--VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYL 647
            SV  + + DL GKRVF+R DLNVP+ +   +T D R+RA++PTI+  +  GAKV+++SHLGRP       ++SL P+V  L + L   V++  D +         ++ EG +++LENVRF+K E+K+D   +KK A+L D++V DAFG+AHRA AST G+ KF   + AG L+  ELD L
Sbjct:    2 SVIKMTDLDLAGKRVFIRADLNVPVKEG-KVTSDARIRASLPTIELALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDG------VDVAEGELVVLENVRFNKGEKKDDEALSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDAL 174          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_SALPA (Phosphoglycerate kinase OS=Salmonella paratyphi A GN=pgk PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.848e-34
Identity = 80/180 (44.44%), Postives = 117/180 (65.00%), Query Frame = 3
Query:  114 SVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG--VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYL 647
            SV  + + DL GKRVF+R DLNVP+ +   +T D R+RA++PTI+  +  GAKV+++SHLGRP       ++SL P+V  L + L   V++  D +         ++ EG +++LENVRF+K E+K+D   +KK A+L D++V DAFG+AHRA AST G+ KF   + AG L+  ELD L
Sbjct:    2 SVIKMTDLDLAGKRVFIRADLNVPVKEG-KVTSDARIRASLPTIELALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDG------VDVAEGELVVLENVRFNKGEKKDDEALSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDAL 174          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_SALNS (Phosphoglycerate kinase OS=Salmonella newport (strain SL254) GN=pgk PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.848e-34
Identity = 80/180 (44.44%), Postives = 117/180 (65.00%), Query Frame = 3
Query:  114 SVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG--VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYL 647
            SV  + + DL GKRVF+R DLNVP+ +   +T D R+RA++PTI+  +  GAKV+++SHLGRP       ++SL P+V  L + L   V++  D +         ++ EG +++LENVRF+K E+K+D   +KK A+L D++V DAFG+AHRA AST G+ KF   + AG L+  ELD L
Sbjct:    2 SVIKMTDLDLAGKRVFIRADLNVPVKEG-KVTSDARIRASLPTIELALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDG------VDVAEGELVVLENVRFNKGEKKDDEALSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDAL 174          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_SALHS (Phosphoglycerate kinase OS=Salmonella heidelberg (strain SL476) GN=pgk PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.848e-34
Identity = 80/180 (44.44%), Postives = 117/180 (65.00%), Query Frame = 3
Query:  114 SVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG--VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYL 647
            SV  + + DL GKRVF+R DLNVP+ +   +T D R+RA++PTI+  +  GAKV+++SHLGRP       ++SL P+V  L + L   V++  D +         ++ EG +++LENVRF+K E+K+D   +KK A+L D++V DAFG+AHRA AST G+ KF   + AG L+  ELD L
Sbjct:    2 SVIKMTDLDLAGKRVFIRADLNVPVKEG-KVTSDARIRASLPTIELALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDG------VDVAEGELVVLENVRFNKGEKKDDEALSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDAL 174          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_SALG2 (Phosphoglycerate kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pgk PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.848e-34
Identity = 80/180 (44.44%), Postives = 117/180 (65.00%), Query Frame = 3
Query:  114 SVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG--VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYL 647
            SV  + + DL GKRVF+R DLNVP+ +   +T D R+RA++PTI+  +  GAKV+++SHLGRP       ++SL P+V  L + L   V++  D +         ++ EG +++LENVRF+K E+K+D   +KK A+L D++V DAFG+AHRA AST G+ KF   + AG L+  ELD L
Sbjct:    2 SVIKMTDLDLAGKRVFIRADLNVPVKEG-KVTSDARIRASLPTIELALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDG------VDVAEGELVVLENVRFNKGEKKDDEALSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDAL 174          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_SALEP (Phosphoglycerate kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=pgk PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.848e-34
Identity = 80/180 (44.44%), Postives = 117/180 (65.00%), Query Frame = 3
Query:  114 SVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG--VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYL 647
            SV  + + DL GKRVF+R DLNVP+ +   +T D R+RA++PTI+  +  GAKV+++SHLGRP       ++SL P+V  L + L   V++  D +         ++ EG +++LENVRF+K E+K+D   +KK A+L D++V DAFG+AHRA AST G+ KF   + AG L+  ELD L
Sbjct:    2 SVIKMTDLDLAGKRVFIRADLNVPVKEG-KVTSDARIRASLPTIELALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDG------VDVAEGELVVLENVRFNKGEKKDDEALSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDAL 174          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_SALDC (Phosphoglycerate kinase OS=Salmonella dublin (strain CT_02021853) GN=pgk PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.848e-34
Identity = 80/180 (44.44%), Postives = 117/180 (65.00%), Query Frame = 3
Query:  114 SVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG--VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYL 647
            SV  + + DL GKRVF+R DLNVP+ +   +T D R+RA++PTI+  +  GAKV+++SHLGRP       ++SL P+V  L + L   V++  D +         ++ EG +++LENVRF+K E+K+D   +KK A+L D++V DAFG+AHRA AST G+ KF   + AG L+  ELD L
Sbjct:    2 SVIKMTDLDLAGKRVFIRADLNVPVKEG-KVTSDARIRASLPTIELALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDG------VDVAEGELVVLENVRFNKGEKKDDEALSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDAL 174          
The following BLAST results are available for this feature:
BLAST of FC920398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
PGK_SALTI4.848e-3444.44Phosphoglycerate kinase OS=Salmonella typhi GN=pgk... [more]
PGK_SALSV4.848e-3444.44Phosphoglycerate kinase OS=Salmonella schwarzengru... [more]
PGK_SALPK4.848e-3444.44Phosphoglycerate kinase OS=Salmonella paratyphi A ... [more]
PGK_SALPB4.848e-3444.44Phosphoglycerate kinase OS=Salmonella paratyphi B ... [more]
PGK_SALPA4.848e-3444.44Phosphoglycerate kinase OS=Salmonella paratyphi A ... [more]
PGK_SALNS4.848e-3444.44Phosphoglycerate kinase OS=Salmonella newport (str... [more]
PGK_SALHS4.848e-3444.44Phosphoglycerate kinase OS=Salmonella heidelberg (... [more]
PGK_SALG24.848e-3444.44Phosphoglycerate kinase OS=Salmonella gallinarum (... [more]
PGK_SALEP4.848e-3444.44Phosphoglycerate kinase OS=Salmonella enteritidis ... [more]
PGK_SALDC4.848e-3444.44Phosphoglycerate kinase OS=Salmonella dublin (stra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007G09EF RVDevelop1 Citrus clementina cDNA clone C32007G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920398 ID=FC920398|Name=FC920398|organism=Citrus clementina|type=EST|length=663bp
GATTTTCTCACTTAGCGTTCACCAATCTTCGATCTCATTCCAAAATCTAA
CCAAAACCCCTTCTCGATTTCTCCGATCTCGTGTTTGATCGAATCAAAAT
GGCCGCCAAGAAGAGTGTAAGCGTTCTAAAAGAAGCTGATTTGAAGGGAA
AGAGAGTGTTCGTACGAGTGGATCTGAACGTGCCGTTGGATGACAACTTG
AATATCACCGATGACAACAGAGTCCGTGCTGCTGTTCCCACTATCAAATA
CCTGATGGGTCATGGCGCCAAAGTCATTCTCTCCAGTCACTTGGGGCGTC
CAAAGGGTGTTACACCCAAGTACAGCTTGAAACCTCTTGTGCCAAGGCTT
TCTGAACTTCTTGGAGTTGAGGTTAAAATGGCAAACGACTGCATTGGTGA
AGAAGTTGAAAAAATGGTGGCTGAAATTCCCGAAGGGGGCGTCTTGCTCC
TCGAAAATGTGAGGTTCCATAAGGAGGAAGAGAAGAATGACCCAGAGTTT
GCTAAGAAGCTAGCTTCTCTTGCAGATCTCTATGTTAATGATGCATTCGG
ATCTGCCCATAGAGCCCATGCTTCCACTGAGGGTGTGGCTAAGTTCTTGA
AGCCTTCTGTGGCTGGTTTCCTTATGNCAAAGGAACTAGATTATCTTGTT
GGAGCTGTTTCAA
back to top