FC920398

Overview
NameFC920398
Unique NameFC920398
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length663
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14268 contig Ccv1_Contig14268:4..666. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_COPPD (Phosphoglycerate kinase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=pgk PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 5.156e-52
Identity = 105/175 (60.00%), Postives = 134/175 (76.57%), Query Frame = 3
Query:  126 LKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKGVTPK-YSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYL 647
            +++A+++ KRV VRVD NVPLD   N+ DD R+RAA+PTI+YL+ +GAKVIL SHLGRPKG   K YSL  +  RL+ELL  E+  A D +GEEVE  V  +  G +LL ENVRFH+EEEKND EFAK +ASL +++VNDAF ++HRAHA+ EG+ KFL PS AGFLM KE++YL
Sbjct:    6 IRDAEVRNKRVIVRVDFNVPLDAEGNVVDDFRIRAALPTIEYLVENGAKVILISHLGRPKGKRDKKYSLVGVAKRLAELLHKEILFAPDVVGEEVELAVNGLRSGDILLCENVRFHEEEEKNDAEFAKNIASLGEIFVNDAFSASHRAHATVEGITKFL-PSYAGFLMEKEVNYL 179          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_BACCZ (Phosphoglycerate kinase OS=Bacillus cereus (strain ZK / E33L) GN=pgk PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 5.156e-52
Identity = 110/186 (59.14%), Postives = 142/186 (76.34%), Query Frame = 3
Query:  108 KKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAVS 662
            KKS+   ++ DLKGKRVF RVD NVP+ +   ITD+ R+RAA+PTI+YL+  GAKVIL+SHLGRPKG V  +  L P+  RL ELLG +VK A++  G  V++MVA + EG VL+LENVRF+  EEKND E AK+ A+LAD++VNDAFG+AHRAHAST G+A +L P+V+G LM KEL+ L  A+S
Sbjct:    3 KKSI---RDVDLKGKRVFCRVDFNVPMKEG-KITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQVVEEMRLTPVAARLGELLGKDVKKADEAFGPAVQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYL-PAVSGLLMEKELEVLGKALS 183          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_BACLD (Phosphoglycerate kinase OS=Bacillus licheniformis (strain DSM 13 / ATCC 14580) GN=pgk PE=3 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 6.733e-52
Identity = 108/186 (58.06%), Postives = 141/186 (75.81%), Query Frame = 3
Query:  108 KKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAVS 662
            KKSV   K+ D+KG+ VF RVD NVP+ D   +TDD R+RAA+PTI+YL   GAKV+L+SHLGRPKG V+ +  L P+  RL EL+G EVK A++  G+ V+  ++E+ +G +L+LENVRF+  EEKNDPE +K  A LAD+YVNDAFG+AHRAHAST G+A+ L P+VAGFLM KEL+ L  A+S
Sbjct:    3 KKSV---KDIDVKGRVVFCRVDFNVPMKDG-KVTDDTRIRAALPTIQYLTEQGAKVLLASHLGRPKGQVSEELRLTPVAARLGELIGKEVKKADEAYGDAVKAQISEMKDGDILVLENVRFYPGEEKNDPELSKAFADLADVYVNDAFGAAHRAHASTAGIAEHL-PAVAGFLMEKELEVLGKALS 183          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_BACCQ (Phosphoglycerate kinase OS=Bacillus cereus (strain Q1) GN=pgk PE=3 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 6.733e-52
Identity = 110/186 (59.14%), Postives = 141/186 (75.81%), Query Frame = 3
Query:  108 KKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAVS 662
            KKS+   ++ DLKGKRVF RVD NVP+ +   ITD+ R+RAA+PTI+YL+  GAKVIL+SHLGRPKG V  +  L P+  RL ELLG +VK A++  G   ++MVA + EG VL+LENVRF+  EEKND E AK+ A+LAD++VNDAFG+AHRAHAST G+A +L P+V+G LM KELD L  A+S
Sbjct:    3 KKSI---RDVDLKGKRVFCRVDFNVPMKEG-KITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQVVEELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYL-PAVSGLLMEKELDVLGKALS 183          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_BACC7 (Phosphoglycerate kinase OS=Bacillus cereus (strain AH187) GN=pgk PE=3 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 6.733e-52
Identity = 110/186 (59.14%), Postives = 141/186 (75.81%), Query Frame = 3
Query:  108 KKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAVS 662
            KKS+   ++ DLKGKRVF RVD NVP+ +   ITD+ R+RAA+PTI+YL+  GAKVIL+SHLGRPKG V  +  L P+  RL ELLG +VK A++  G   ++MVA + EG VL+LENVRF+  EEKND E AK+ A+LAD++VNDAFG+AHRAHAST G+A +L P+V+G LM KELD L  A+S
Sbjct:    3 KKSI---RDVDLKGKRVFCRVDFNVPMKEG-KITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQVVEELRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYL-PAVSGLLMEKELDVLGKALS 183          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_BACC4 (Phosphoglycerate kinase OS=Bacillus cereus (strain B4264) GN=pgk PE=3 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 6.733e-52
Identity = 110/186 (59.14%), Postives = 141/186 (75.81%), Query Frame = 3
Query:  108 KKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAVS 662
            KKS+   ++ DLKGKRVF RVD NVP+ +   ITD+ R+RAA+PTI+YL+  GAKVIL+SHLGRPKG V  +  L P+  RL ELLG +VK A++  G   ++MVA + EG VL+LENVRF+  EEKND E AK+ A+LAD++VNDAFG+AHRAHAST G+A +L P+V+G LM KELD L  A+S
Sbjct:    3 KKSI---RDVDLKGKRVFCRVDFNVPMKEG-KITDETRIRAALPTIQYLVEQGAKVILASHLGRPKGQVVEEMRLTPVAARLGELLGKDVKKADEAFGPVAQEMVAAMNEGDVLVLENVRFYAGEEKNDAELAKEFAALADIFVNDAFGAAHRAHASTAGIADYL-PAVSGLLMEKELDVLGKALS 183          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_CHLL2 (Phosphoglycerate kinase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=pgk PE=3 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 8.794e-52
Identity = 100/175 (57.14%), Postives = 134/175 (76.57%), Query Frame = 3
Query:  126 LKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKGVTPK-YSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYL 647
            L +  ++GKRV +RVD NVPLD+  NITDD R+  A+P+IK ++ +G ++IL SHLGRPKG   + +SL P   RLSELL   V MA DCIG EV + V  + +G V++LEN+RFH EEE NDP+FAK+LASL ++YVNDAFG+AHRAHASTEG+ ++++ +VAG+L+ KEL YL
Sbjct:    6 LSDITIQGKRVLMRVDFNVPLDEEKNITDDKRIVEALPSIKKIIENGGRLILMSHLGRPKGKPNQDFSLTPAAERLSELLDCPVIMAGDCIGTEVMQQVLALQDGEVIMLENLRFHPEEEANDPDFAKELASLGEIYVNDAFGTAHRAHASTEGITRYVQTAVAGYLIEKELMYL 180          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_CHLAD (Phosphoglycerate kinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=pgk PE=3 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 8.794e-52
Identity = 109/182 (59.89%), Postives = 132/182 (72.53%), Query Frame = 3
Query:  126 LKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELL--GVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAVS 662
            +++ D  GKR  VRVD NVPLD+   ITDD R+RAA+PTI+YL+ HGAKVIL SHLGRPKG   PKYSL+P+V RL ELL    EVK      G   E  V+ +  G VL+LEN RF   EE NDP+ A +LA L D++VNDAFG+AHRA+ASTEGVA +L P+VAGFLM KEL Y+ GA+S
Sbjct:    6 IRDVDWAGKRALVRVDFNVPLDEQGQITDDTRIRAALPTIRYLLEHGAKVILMSHLGRPKGKPNPKYSLRPVVERLFELLPEATEVKKTEAITGPAAEAAVSMLKPGQVLVLENTRFDPREEANDPQMAAELAKLGDVFVNDAFGTAHRANASTEGVAHYL-PAVAGFLMEKELTYIGGALS 186          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_CHLCH (Phosphoglycerate kinase OS=Chlorobium chlorochromatii (strain CaD3) GN=pgk PE=3 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.149e-51
Identity = 101/175 (57.71%), Postives = 133/175 (76.00%), Query Frame = 3
Query:  126 LKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYL 647
            L +   +GKRV +RVD NVPLD+N NITDD R+  ++P+I+ ++  G ++IL SHLGRPKG V  ++SL P+  RLSELL   V MA DCIG EV + V  + +G VLLLEN+RFH EEE ND +FAK+LASL ++YVNDAFG+AHRAHASTEG+  +++ +VAGFL+ +EL YL
Sbjct:    6 LSDIATQGKRVLMRVDFNVPLDENKNITDDKRIVESLPSIRKVIEEGGRLILMSHLGRPKGKVNAEFSLAPVAARLSELLDCPVGMAKDCIGTEVMQQVLALQDGEVLLLENLRFHAEEEANDADFAKELASLGEIYVNDAFGTAHRAHASTEGITHYVQTAVAGFLIERELRYL 180          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_PROVI (Phosphoglycerate kinase OS=Prosthecochloris vibrioformis (strain DSM 265) (strain DSM 265) GN=pgk PE=3 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.500e-51
Identity = 98/175 (56.00%), Postives = 132/175 (75.43%), Query Frame = 3
Query:  126 LKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYL 647
            L +  ++GKR+ +RVD NVPL+D   ITDD R+  A+P+I+ ++ +G ++IL SHLGRPKG V P +SL P+  +LSEL+   V MA DCIG EV +    + +G V+LLEN+RFH EEE NDPEFAK+LA+L ++YVNDAFG+AHRAHASTEG+  F+  +VAG+L+ KEL YL
Sbjct:    6 LSDITIQGKRILMRVDFNVPLNDEREITDDKRIVEALPSIRKILDNGGRLILMSHLGRPKGKVNPIFSLAPVAAKLSELIDTPVAMAEDCIGTEVMQSALALQDGEVMLLENLRFHPEEEANDPEFAKELAALGEMYVNDAFGTAHRAHASTEGITHFVPTAVAGYLIEKELMYL 180          
The following BLAST results are available for this feature:
BLAST of FC920398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
PGK_COPPD5.156e-5260.00Phosphoglycerate kinase OS=Coprothermobacter prote... [more]
PGK_BACCZ5.156e-5259.14Phosphoglycerate kinase OS=Bacillus cereus (strain... [more]
PGK_BACLD6.733e-5258.06Phosphoglycerate kinase OS=Bacillus licheniformis ... [more]
PGK_BACCQ6.733e-5259.14Phosphoglycerate kinase OS=Bacillus cereus (strain... [more]
PGK_BACC76.733e-5259.14Phosphoglycerate kinase OS=Bacillus cereus (strain... [more]
PGK_BACC46.733e-5259.14Phosphoglycerate kinase OS=Bacillus cereus (strain... [more]
PGK_CHLL28.794e-5257.14Phosphoglycerate kinase OS=Chlorobium limicola (st... [more]
PGK_CHLAD8.794e-5259.89Phosphoglycerate kinase OS=Chloroflexus aggregans ... [more]
PGK_CHLCH1.149e-5157.71Phosphoglycerate kinase OS=Chlorobium chlorochroma... [more]
PGK_PROVI1.500e-5156.00Phosphoglycerate kinase OS=Prosthecochloris vibrio... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007G09EF RVDevelop1 Citrus clementina cDNA clone C32007G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920398 ID=FC920398|Name=FC920398|organism=Citrus clementina|type=EST|length=663bp
GATTTTCTCACTTAGCGTTCACCAATCTTCGATCTCATTCCAAAATCTAA
CCAAAACCCCTTCTCGATTTCTCCGATCTCGTGTTTGATCGAATCAAAAT
GGCCGCCAAGAAGAGTGTAAGCGTTCTAAAAGAAGCTGATTTGAAGGGAA
AGAGAGTGTTCGTACGAGTGGATCTGAACGTGCCGTTGGATGACAACTTG
AATATCACCGATGACAACAGAGTCCGTGCTGCTGTTCCCACTATCAAATA
CCTGATGGGTCATGGCGCCAAAGTCATTCTCTCCAGTCACTTGGGGCGTC
CAAAGGGTGTTACACCCAAGTACAGCTTGAAACCTCTTGTGCCAAGGCTT
TCTGAACTTCTTGGAGTTGAGGTTAAAATGGCAAACGACTGCATTGGTGA
AGAAGTTGAAAAAATGGTGGCTGAAATTCCCGAAGGGGGCGTCTTGCTCC
TCGAAAATGTGAGGTTCCATAAGGAGGAAGAGAAGAATGACCCAGAGTTT
GCTAAGAAGCTAGCTTCTCTTGCAGATCTCTATGTTAATGATGCATTCGG
ATCTGCCCATAGAGCCCATGCTTCCACTGAGGGTGTGGCTAAGTTCTTGA
AGCCTTCTGTGGCTGGTTTCCTTATGNCAAAGGAACTAGATTATCTTGTT
GGAGCTGTTTCAA
back to top