FC920403

Overview
NameFC920403
Unique NameFC920403
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length689
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..695. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: THS2_ARAHY (Putative stilbene synthase 2 (Fragment) OS=Arachis hypogaea PE=5 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 5.373e-54
Identity = 85/106 (80.19%), Postives = 96/106 (90.57%), Query Frame = 2
Query:  281 LKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            LKENPNMCAY APSLDAR+D+++ EVP++GKEAATKAIKEWGQP SKITHLIFCTTSGV +PG DY+L  L+GL PSVKR+MMY QGCFAGGTVLRLAKDLAEN +
Sbjct:    1 LKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGVDYELIVLLGLDPSVKRYMMYHQGCFAGGTVLRLAKDLAENNK 106          

HSP 2 Score: 50.447 bits (119), Expect = 5.373e-54
Identity = 23/31 (74.19%), Postives = 28/31 (90.32%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +K ARVL+VCSE TAVTFRGP++T +DSLVG
Sbjct:  105 NKDARVLIVCSENTAVTFRGPSETDMDSLVG 135          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS6_MEDSA (Chalcone synthase 6-4 (Fragment) OS=Medicago sativa GN=CHS6-4 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.350e-48
Identity = 72/78 (92.31%), Postives = 75/78 (96.15%), Query Frame = 2
Query:  365 LGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 LGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 78          

HSP 2 Score: 61.6178 bits (148), Expect = 2.350e-48
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSE+TAVTFRGP+DTHLDSLVG
Sbjct:   77 NKGARVLVVCSEVTAVTFRGPSDTHLDSLVG 107          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS7_MEDSA (Chalcone synthase (Fragment) OS=Medicago sativa GN=CHSII PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.121e-34
Identity = 52/59 (88.14%), Postives = 55/59 (93.22%), Query Frame = 2
Query:  422 ITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            ITHLI CTTS VDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 ITHLIVCTTS-VDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 58          

HSP 2 Score: 61.6178 bits (148), Expect = 1.121e-34
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSE+TAVTFRGP+DTHLDSLVG
Sbjct:   57 NKGARVLVVCSEVTAVTFRGPSDTHLDSLVG 87          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSY_MALDO (Chalcone synthase (Fragment) OS=Malus domestica GN=CHS PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.563e-18
Identity = 29/31 (93.55%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSEITAVTFRGP+DTHLDSLVG
Sbjct:   24 NKGARVLVVCSEITAVTFRGPSDTHLDSLVG 54          

HSP 2 Score: 51.6026 bits (122), Expect = 1.563e-18
Identity = 23/25 (92.00%), Postives = 24/25 (96.00%), Query Frame = 2
Query:  524 MMYQQGCFAGGTVLRLAKDLAENTR 598
            MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MMYQQGCFAGGTVLRLAKDLAENNK 25          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: PKS1_DICDI (Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 6.158e-16
Identity = 54/196 (27.55%), Postives = 99/196 (50.51%), Query Frame = 2
Query:    2 TLTKHEPQTYSLRVQLEMATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAE 589
            ++ +H+ Q   ++V ++       R + +++  + VL IG + P   ++Q    D        +   E  EK KR+ ++S IK R++ + +    EN     ++    D       V VP L ++A  +A+K+WG  K  ITH++  T++G+ +P  +++L  L+GL   V+R  +   GC AG + LR A  LA+
Sbjct: 2755 SVQQHQKQQQKVQV-IQQQQQPLSRLSYKSNNNSFVLGIGISVPGEPISQQSLKDSISNDFSDK--AETNEKVKRIFEQSQIKTRHL-VRDYTKPENSIKFRHLETITDVNNQFKKV-VPDLAQQACLRALKDWGGDKGDITHIVSVTSTGIIIPDVNFKLIDLLGLNKDVERVSLNLMGCLAGLSSLRTAASLAK 2945          

HSP 2 Score: 21.1718 bits (43), Expect = 6.158e-16
Identity = 7/14 (50.00%), Postives = 12/14 (85.71%), Query Frame = 1
Query:  604 RVLVVCSEITAVTF 645
            R+LVVC+E+ ++ F
Sbjct: 2951 RILVVCTEVCSLHF 2964          
The following BLAST results are available for this feature:
BLAST of FC920403 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
THS2_ARAHY5.373e-5480.19Putative stilbene synthase 2 (Fragment) OS=Arachis... [more]
CHS6_MEDSA2.350e-4892.31Chalcone synthase 6-4 (Fragment) OS=Medicago sativ... [more]
CHS7_MEDSA1.121e-3488.14Chalcone synthase (Fragment) OS=Medicago sativa GN... [more]
CHSY_MALDO1.563e-1893.55Chalcone synthase (Fragment) OS=Malus domestica GN... [more]
PKS1_DICDI6.158e-1627.55Probable polyketide synthase 1 OS=Dictyostelium di... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H02EF RVDevelop1 Citrus clementina cDNA clone C32007H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920403 ID=FC920403|Name=FC920403|organism=Citrus clementina|type=EST|length=689bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGC
back to top