FC920405

Overview
NameFC920405
Unique NameFC920405
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length708
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14135 contig Ccv1_Contig14135:1..708. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_DROME (60S ribosomal protein L5 OS=Drosophila melanogaster GN=RpL5 PE=1 SV=2)

HSP 1 Score: 238.424 bits (607), Expect = 2.813e-62
Identity = 120/201 (59.70%), Postives = 147/201 (73.13%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTEN-RRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K  K+K YFKRYQVK++RRREGKTDY AR RL  QDKNKYNTPKYR +VR +NKDIT QI  A I GD V+ +AY+HELP+YG++VGLTNYAAAYCTGLL+ARRVL  L +D+ Y G  E TGE+++VEP ++    FR  LDVGL +TTTG RVF            IPHS KRF G+S ++K  +A+VHR +I+   VA
Sbjct:    5 KVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTFQDKNKYNTPKYRLIVRLSNKDITVQIAYARIEGDRVVCAAYSHELPKYGIQVGLTNYAAAYCTGLLVARRVLNKLGLDSLYAGCTEVTGEEFNVEPVDDGPGAFRCFLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRFPGYSAETKSFNADVHRAHIFGQHVA 205          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_DUNSA (60S ribosomal protein L5 OS=Dunaliella salina GN=RPL5 PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 3.673e-62
Identity = 117/201 (58.21%), Postives = 150/201 (74.63%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTEN-RRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K  K+  YF RYQVKY+RRR+GKTDYRAR+RL+ QDKNKYNT KYR VVRF+NK++T QI+ ++I GD+V+A+AY+ ELP YGL+VGLTNY+AAYC GLL+ARR+L  L +   Y+G  E  GEDY+VEP E+  +PF  LLD GL +T+TG++VF            IPH+EKRF G++   K+LD EV +KYIY G VA
Sbjct:    5 KVVKTSPYFSRYQVKYRRRRQGKTDYRARLRLVRQDKNKYNTHKYRLVVRFSNKNVTCQIVYSTIQGDVVMAAAYSKELPNYGLKVGLTNYSAAYCVGLLVARRILTKLNLADTYKGQEEPDGEDYNVEPVEDGPKPFYCLLDTGLKRTSTGSKVFAAMKGALDGGLDIPHNEKRFVGYA--DKKLDTEVLQKYIYGGHVA 203          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_AEDAE (60S ribosomal protein L5 OS=Aedes aegypti GN=RpL5 PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 3.673e-62
Identity = 118/201 (58.71%), Postives = 147/201 (73.13%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTEN-RRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K  K+K YFKRYQV+++RRREGKTDY AR RLI QDKNKYNTPKYR +VR +N+DIT QI  A I GD ++ +AY+HELPRYG++VGLTNYAAAYCTGLL+ARR+L+ L +D  Y G  + TGE+Y VEP ++    FR  LDVGL +TTTG R+F            IPHS KRF G+S ++K  +AEVHR +I+   VA
Sbjct:    5 KVVKNKQYFKRYQVRFRRRREGKTDYYARKRLIFQDKNKYNTPKYRLIVRLSNRDITCQIAYARIEGDRIVCAAYSHELPRYGVKVGLTNYAAAYCTGLLVARRILQKLRLDTLYTGCTDVTGEEYLVEPVDDGPGAFRCYLDVGLARTTTGARIFGAMKGAVDGGLNIPHSVKRFPGYSAENKSFNAEVHRAHIFGQHVA 205          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_BOMMO (60S ribosomal protein L5 OS=Bombyx mori GN=RpL5 PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 4.798e-62
Identity = 117/201 (58.21%), Postives = 147/201 (73.13%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTEN-RRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K  K+K YFKRYQVK+KRRREGKTDY AR RL+ QDKNKYNTPKYR +VR +NKD+T Q+  + I GD ++ +AY+HELPRYG++VGLTNYAAAY TGLLLARR+L+ L +D  Y G  + TG++Y+VEP +N    FR  LDVGL +TTTG RVF            +PHS KRF G+  +SK+ +AEVHR +I+   VA
Sbjct:    5 KVVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQVAYSRIEGDHIVCAAYSHELPRYGVKVGLTNYAAAYSTGLLLARRLLQRLGLDTLYTGTTDVTGDEYNVEPVDNGPGAFRCYLDVGLARTTTGRRVFGAMKGAVDGGLNVPHSIKRFPGYDAESKKFNAEVHRAHIFGLHVA 205          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_ANOGA (60S ribosomal protein L5 OS=Anopheles gambiae GN=RpL5 PE=2 SV=3)

HSP 1 Score: 236.113 bits (601), Expect = 1.396e-61
Identity = 118/201 (58.71%), Postives = 146/201 (72.64%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPT-ENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K  K+K YFKRYQV+++RRREGKTDY AR RLI QDKNKYNTPK+R +VR +N+DIT QI  A I GD ++ +AY+HELPRYG++VGLTNYAAAYCTGLL+ARR+L+ L +D  Y G  + TGE+Y VEP  E    FR  LDVGL +TTTG RVF            IPHS KRF G+S ++K  +AE+HR +I+   VA
Sbjct:    5 KVVKNKQYFKRYQVRFRRRREGKTDYYARKRLIFQDKNKYNTPKFRLIVRLSNRDITCQIAYARIEGDRIVCAAYSHELPRYGVKVGLTNYAAAYCTGLLVARRILQKLRLDTLYAGCTDVTGEEYLVEPVDEGPAAFRCYLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRFPGYSAENKSFNAEMHRDHIFGLHVA 205          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_LYSTE (60S ribosomal protein L5 OS=Lysiphlebus testaceipes GN=RpL5 PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 5.304e-61
Identity = 114/201 (56.72%), Postives = 145/201 (72.14%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEP-TENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K  K+K YFKR+QVKYKRRREGKTDY AR RL  QDK+KYNTPKYR +VR +NKDIT QI  + I GD ++ +AY+HELP+YG++VGLTNYAAAYCTGLLLARR+LK L++D  Y G  E  G++Y+VE   +    FR  LD GL++TTTG R+F            IPHS KRF G+  +SK  +A+VHR++I+   +A
Sbjct:    5 KVVKNKQYFKRFQVKYKRRREGKTDYYARKRLTVQDKSKYNTPKYRLIVRLSNKDITCQIAYSRIEGDRIVCAAYSHELPKYGIKVGLTNYAAAYCTGLLLARRLLKQLKLDTLYTGTTEVDGDEYNVEEHDDGPGAFRCYLDTGLMRTTTGARIFGAMKGAVDGGLNIPHSTKRFPGYDNESKSFNADVHRQHIFAHHIA 205          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_NEUCR (60S ribosomal protein L5 OS=Neurospora crassa GN=rpl-5 PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 7.659e-60
Identity = 121/204 (59.31%), Postives = 142/204 (69.61%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTE----NRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K  K+ AY+ R+Q KYKRRREGKTDY AR RLI Q KNKYN PKYR VVRFTN+DI  QI+S+ I GD V ASAY+HEL  YG+E GLTN+AAAY TGLLLARRVLK L +D  ++G  EA GE    E  E     RRPF+A LDVGL +T+TG RVF            IPHSE RF G+  +S++LDAE  +KYI+ G VA
Sbjct:    5 KLVKNSAYYSRFQTKYKRRREGKTDYYARKRLITQAKNKYNAPKYRLVVRFTNRDIILQIVSSEITGDKVFASAYSHELKAYGIEHGLTNWAAAYATGLLLARRVLKKLGLDETFKGVEEADGEYKLTEAAETDDGERRPFKAFLDVGLARTSTGARVFGAMKGASDGGIFIPHSENRFPGYDMESEELDAETLKKYIFGGHVA 208          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_THEPA (60S ribosomal protein L5 OS=Theileria parva GN=RPL5 PE=3 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 1.106e-58
Identity = 117/201 (58.21%), Postives = 147/201 (73.13%), Query Frame = 3
Query:  114 KSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTEN-RRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSK---QLDAEVHRKYIYCGRVA 704
            K+KAYF+R+QVK++RRREGKTDY AR RL+ QDKNKY++PKYR VVR TNK +  QI+S+++ GD V ASA + EL  YG++VGLTNYAAAYCTGLLLARR+L  L++D+++ G VEA GE Y VE  +N RRPF+ALLDVG+   TTGNRVF            +PHSEKRF G+S D +     DA+ HR  I+   VA
Sbjct:    8 KNKAYFRRFQVKFRRRREGKTDYYARRRLVAQDKNKYDSPKYRLVVRLTNKRVICQIVSSTLVGDKVHASADSSELVHYGVKVGLTNYAAAYCTGLLLARRLLTKLKLDSQFVGKVEADGELYHVEEEDNERRPFKALLDVGIKNVTTGNRVFGALKGACDGGLHVPHSEKRFPGYSVDDENNGSYDAQAHRDRIFGTHVA 208          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_THEAN (60S ribosomal protein L5 OS=Theileria annulata GN=RPL5 PE=3 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 1.106e-58
Identity = 117/201 (58.21%), Postives = 147/201 (73.13%), Query Frame = 3
Query:  114 KSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTEN-RRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQ---LDAEVHRKYIYCGRVA 704
            K+KAYF+R+QVK++RRREGKTDY AR RL+ QDKNKY++PKYR VVR TNK +  QI+S+++ GD V ASA + EL  YG++VGLTNYAAAYCTGLLLARR+L  L++D+++ G VEA GE Y VE  +N RRPF+ALLDVG+   TTGNRVF            +PHSEKRF G+S D +     DA+ HR  I+   VA
Sbjct:    8 KNKAYFRRFQVKFRRRREGKTDYYARRRLVAQDKNKYDSPKYRLVVRLTNKRVICQIVSSTLVGDKVHASADSSELVHYGVKVGLTNYAAAYCTGLLLARRLLTKLKLDSQFVGKVEADGELYHVEEDDNERRPFKALLDVGIKNVTTGNRVFGALKGACDGGLHVPHSEKRFPGYSVDDENNGTYDAQAHRDRIFGTHVA 208          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_OIKDI (60S ribosomal protein L5 OS=Oikopleura dioica GN=RPL5 PE=3 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 6.069e-57
Identity = 114/197 (57.87%), Postives = 138/197 (70.05%), Query Frame = 3
Query:  114 KSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGED-YSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRV 701
            K+KAYFKRYQ K+KRRREGKTDY AR RL  QDKNKYNTPKYR VVR TNKDI AQI  A + GD+++ SAYAHELPRYG+ VGLTNY+AAY TGLL+ RRVL+   +D+ YEG +E  G++ Y       +  FR  LD GL +T+TG R+F            IPHS KRF GF+ D K L+AE H+ +I+ G V
Sbjct:   18 KNKAYFKRYQPKFKRRREGKTDYFARKRLCVQDKNKYNTPKYRLVVRVTNKDIIAQIAYARLQGDVIVTSAYAHELPRYGVSVGLTNYSAAYATGLLIGRRVLQKFGLDSMYEGQIEVDGDEFYEEADAAEKASFRCYLDTGLARTSTGARIFGVLKGCADAGIDIPHSPKRFPGFA-DGK-LNAEAHKDHIFGGHV 212          
The following BLAST results are available for this feature:
BLAST of FC920405 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
RL5_DROME2.813e-6259.7060S ribosomal protein L5 OS=Drosophila melanogaste... [more]
RL5_DUNSA3.673e-6258.2160S ribosomal protein L5 OS=Dunaliella salina GN=R... [more]
RL5_AEDAE3.673e-6258.7160S ribosomal protein L5 OS=Aedes aegypti GN=RpL5 ... [more]
RL5_BOMMO4.798e-6258.2160S ribosomal protein L5 OS=Bombyx mori GN=RpL5 PE... [more]
RL5_ANOGA1.396e-6158.7160S ribosomal protein L5 OS=Anopheles gambiae GN=R... [more]
RL5_LYSTE5.304e-6156.7260S ribosomal protein L5 OS=Lysiphlebus testaceipe... [more]
RL5_NEUCR7.659e-6059.3160S ribosomal protein L5 OS=Neurospora crassa GN=r... [more]
RL5_THEPA1.106e-5858.2160S ribosomal protein L5 OS=Theileria parva GN=RPL... [more]
RL5_THEAN1.106e-5858.2160S ribosomal protein L5 OS=Theileria annulata GN=... [more]
RL5_OIKDI6.069e-5757.8760S ribosomal protein L5 OS=Oikopleura dioica GN=R... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H05EF RVDevelop1 Citrus clementina cDNA clone C32007H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920405 ID=FC920405|Name=FC920405|organism=Citrus clementina|type=EST|length=708bp
GGAGCGTGTTAGGGTTTAAGTACATTGGATTTAGCTCGCGGCTCCTTCAC
AACTTCTCGAACTCTGCTGCTTCTACACTTTGAGCTTCAGCAATGGCCTT
TGCCAAAGCTCAAAAGTCAAAAGCTTACTTTAAGCGATATCAAGTTAAGT
ACAAGAGAAGGCGAGAGGGAAAGACTGACTATCGGGCTAGGATTCGCCTG
ATCAACCAAGATAAAAACAAGTACAACACGCCAAAGTATCGGTTTGTTGT
GCGATTCACCAACAAAGATATCACTGCACAAATTATATCTGCCAGCATAG
CCGGGGATATAGTCCTTGCATCTGCTTATGCCCATGAGCTTCCCCGTTAT
GGTCTTGAGGTGGGCCTCACTAATTATGCAGCAGCTTATTGCACTGGACT
CCTCTTGGCCCGCCGAGTCCTGAAAATGCTTGAGATGGATGCTGAGTATG
AGGGGAACGTTGAGGCAACAGGAGAGGACTATTCAGTTGAGCCAACTGAG
AACAGGAGGCCTTTCCGTGCCCTGCTTGATGTTGGTCTTGTGAAAACAAC
TACTGGTAACCGTGTCTTTGGCGCTCTTAAGGGTGCATTGGATGGTGGAC
TTGATATCCCTCACAGTGAGAAGAGATTTGCTGGATTCAGTAAGGATAGT
AAGCAACTTGACGCTGAAGTTCACCGTAAATACATCTATTGTGGTCGTGT
CGCTGCCT
back to top