FC920405

Overview
NameFC920405
Unique NameFC920405
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length708
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14135 contig Ccv1_Contig14135:1..708. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_HYPBU (50S ribosomal protein L18P OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.369e-15
Identity = 63/168 (37.50%), Postives = 81/168 (48.21%), Query Frame = 3
Query:  123 AYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHEL-PRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEK 623
            A+  RY+V  +RRREGKT+Y  R  ++   K        RFVVR TN+ I  Q+I A   GD+ +A+A++ EL  +YG   G  N  AAY TGLL A R LK               G  Y            A+LD+GL + T G RVF            IPHSE+
Sbjct:    2 AHGPRYKVPRRRRREGKTNYYKRYVMVLSGKP-------RFVVRRTNQYIWVQVIIAKPQGDVTVAAAHSRELVKKYGWLGGTKNTPAAYLTGLLAALRALK--------------AGITY------------AVLDIGLHRPTRGARVFAALKGALDAGLEIPHSEE 136          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_HALSA (50S ribosomal protein L18P OS=Halobacterium salinarium GN=rpl18p PE=1 SV=3)

HSP 1 Score: 81.6481 bits (200), Expect = 4.400e-15
Identity = 57/178 (32.02%), Postives = 83/178 (46.63%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAE 668
            RY+V  +RRRE +TDY  R+RL+   K        R V R +NK +TAQ+++    GD  +ASA++ +L  YG      N  AAY TGLL  +R +                  D  VE         A+LD+GL   T G++VF            +PH++   A +S+   +  AE
Sbjct:    6 RYKVPMRRRREVRTDYHQRLRLLKSGKP-------RLVARKSNKHVTAQLVTTGPDGDETVASAHSSDLDAYGWAAPTGNLPAAYLTGLLAGQRAV------------------DAGVE--------EAVLDIGLNTATPGSKVFAIQEGAIDAGLDVPHNDSVLADWSRTRGEHIAE 150          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_HALS3 (50S ribosomal protein L18P OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.400e-15
Identity = 57/178 (32.02%), Postives = 83/178 (46.63%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAE 668
            RY+V  +RRRE +TDY  R+RL+   K        R V R +NK +TAQ+++    GD  +ASA++ +L  YG      N  AAY TGLL  +R +                  D  VE         A+LD+GL   T G++VF            +PH++   A +S+   +  AE
Sbjct:    6 RYKVPMRRRREVRTDYHQRLRLLKSGKP-------RLVARKSNKHVTAQLVTTGPDGDETVASAHSSDLDAYGWAAPTGNLPAAYLTGLLAGQRAV------------------DAGVE--------EAVLDIGLNTATPGSKVFAIQEGAIDAGLDVPHNDSVLADWSRTRGEHIAE 150          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_KORCO (50S ribosomal protein L18P OS=Korarchaeum cryptofilum (strain OPF8) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.672e-14
Identity = 57/161 (35.40%), Postives = 75/161 (46.58%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHS 617
            RY+VK++RRREGKTDY  R+ L+   K        R VVR TN+ I  Q I     GD V+A A++ EL +YG   G  N  AAY TG L A R        A+  G  E                  A+LD+G   +T G+R++            +PHS
Sbjct:    6 RYKVKFRRRREGKTDYMKRLALLKSRKP-------RVVVRRTNRYIIVQFIGFKGEGDEVIAYAFSKELEKYGWPYGGKNLPAAYLTGYLAAMR--------AKKAGVTE------------------AILDIGRFPSTKGSRLYAALKGVLDAGIDVPHS 133          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_METTP (50S ribosomal protein L18P OS=Methanosaeta thermophila (strain DSM 6194 / PT) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.184e-14
Identity = 58/183 (31.69%), Postives = 83/183 (45.36%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKY 683
            RY+V ++RRREG+T+Y  R RLI   K        R VVR  N +IT Q+I A + GD  L +  + EL  YG +    N  AAY TGLL  +++L +                 Y+            +LD+GL   + G+RV+            +PHS + F     D  ++  EV R Y
Sbjct:    6 RYRVPFRRRREGRTNYHVRYRLILSRKP-------RVVVRKGNANITIQLIIAELKGDRTLLTVSSKELRNYGFQHSTGNVPAAYLTGLLFGKKMLAL----------------GYN----------EGILDIGLHSNSRGSRVYAALKGVVDAGVDVPHSPEVF----PDDSRIRGEVIRDY 151          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_HALMA (50S ribosomal protein L18P OS=Haloarcula marismortui GN=rpl18p PE=1 SV=3)

HSP 1 Score: 79.337 bits (194), Expect = 2.184e-14
Identity = 55/170 (32.35%), Postives = 77/170 (45.29%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSK 644
            RY+V  +RRRE +TDY  R+RL+   K        R V R +NK + AQ+++    GD  LASA++ +L  YG E    N  +AY TGLL   R           E  VE                  A+LD+GL   T G++VF            IPH++   A + +
Sbjct:    6 RYKVPMRRRREARTDYHQRLRLLKSGKP-------RLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRA---------QEAGVE-----------------EAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQR 142          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_ARCFU (50S ribosomal protein L18P OS=Archaeoglobus fulgidus GN=rpl18p PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.184e-14
Identity = 54/163 (33.13%), Postives = 80/163 (49.08%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEK 623
            RY+V  +RRREGKT+YR R++L+   K        R VVR TN+ + AQI+  +  GD V+    +  L  +G +  L N  AAY TG+L+A++ L+            +  GE              A+LD+GL   T G+RVF            +PHS++
Sbjct:    8 RYKVPLRRRREGKTNYRKRLKLLLSRKP-------RLVVRITNRRVIAQIVEYAPEGDRVVVGVDSAMLREFGWKGDLNNTPAAYLTGILIAKKALQ------------KGIGE--------------AVLDIGLHTPTRGSRVFAVLRGAVEGGLEVPHSDE 137          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_META3 (50S ribosomal protein L18P OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.865e-14
Identity = 57/171 (33.33%), Postives = 82/171 (47.95%), Query Frame = 3
Query:  123 AYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAG 635
            A+  +Y+V ++RRREGKT++R R++L+        TP  R V R +  +I AQI+     GD ++ SA++ E+ + G +    N  AAY TGLLL ++ LK        EGN E                  A+LD+GL   T G  V             IPHSE+   G
Sbjct:    2 AHGAKYRVPFRRRREGKTNFRLRLKLLLS-----RTP--RLVARKSLNNIVAQIVEYDEVGDKIVVSAHSKEIVKLGYKGHCGNVPAAYLTGLLLGKKALK--------EGNEE------------------AILDLGLNSATKGAAVLAILKGAVDAGMDIPHSEEILPG 139          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_CALMQ (50S ribosomal protein L18P OS=Caldivirga maquilingensis (strain DSMZ 13496 / IC-167) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.354e-14
Identity = 62/195 (31.79%), Postives = 93/195 (47.69%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTD-YRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHEL-PRYGLEVGLTNYAAAYCTGLLLARRVL-KMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSE-----------KRFAGFSKDSKQLDAEVHR 677
            RY+VK++RRREGKTD Y+ RI +I        + K R VVRF+N+ + AQ+I ++  GD  +A A + EL  ++G   G  N  AAY  GLL+  R L K +++                           A+LDVGL + T G R+F            +PH E           +  A ++ D KQ + E+++
Sbjct:    6 RYKVKFRRRREGKTDYYKRRIMVI--------SGKPRLVVRFSNRYVLAQVIVSAPQGDFTVAEASSRELVKKFGWLGGTGNTPAAYLVGLLIGYRALSKGIKL---------------------------AVLDVGLHRVTKGGRLFAVVKGAVDAGLEVPHDEEVQPSEDRLNGEHIAQYAADLKQSNPELYK 165          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL18_METLZ (50S ribosomal protein L18P OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpl18p PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.298e-14
Identity = 55/145 (37.93%), Postives = 71/145 (48.97%), Query Frame = 3
Query:  135 RYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVF 569
            RY V+++RRREG+TDY  R RLI   +N       R VVR TN+ I  Q+I+A + GD  L    + EL  +G +  L N  AAY TG+L A R  K     A YEG +                      D+GL   +TG RVF
Sbjct:    6 RYFVQFRRRREGRTDYYQRQRLIVSGRN-------RMVVRKTNRHIIIQLIAAQMDGDYTLVHVNSRELVNFGYKGYLGNTPAAYLTGMLFAVRAQK-----AGYEGGI---------------------ADIGLQVASTGARVF 117          
The following BLAST results are available for this feature:
BLAST of FC920405 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
RL18_HYPBU3.369e-1537.5050S ribosomal protein L18P OS=Hyperthermus butylic... [more]
RL18_HALSA4.400e-1532.0250S ribosomal protein L18P OS=Halobacterium salina... [more]
RL18_HALS34.400e-1532.0250S ribosomal protein L18P OS=Halobacterium salina... [more]
RL18_KORCO1.672e-1435.4050S ribosomal protein L18P OS=Korarchaeum cryptofi... [more]
RL18_METTP2.184e-1431.6950S ribosomal protein L18P OS=Methanosaeta thermop... [more]
RL18_HALMA2.184e-1432.3550S ribosomal protein L18P OS=Haloarcula marismort... [more]
RL18_ARCFU2.184e-1433.1350S ribosomal protein L18P OS=Archaeoglobus fulgid... [more]
RL18_META34.865e-1433.3350S ribosomal protein L18P OS=Methanococcus aeolic... [more]
RL18_CALMQ6.354e-1431.7950S ribosomal protein L18P OS=Caldivirga maquiling... [more]
RL18_METLZ8.298e-1437.9350S ribosomal protein L18P OS=Methanocorpusculum l... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H05EF RVDevelop1 Citrus clementina cDNA clone C32007H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920405 ID=FC920405|Name=FC920405|organism=Citrus clementina|type=EST|length=708bp
GGAGCGTGTTAGGGTTTAAGTACATTGGATTTAGCTCGCGGCTCCTTCAC
AACTTCTCGAACTCTGCTGCTTCTACACTTTGAGCTTCAGCAATGGCCTT
TGCCAAAGCTCAAAAGTCAAAAGCTTACTTTAAGCGATATCAAGTTAAGT
ACAAGAGAAGGCGAGAGGGAAAGACTGACTATCGGGCTAGGATTCGCCTG
ATCAACCAAGATAAAAACAAGTACAACACGCCAAAGTATCGGTTTGTTGT
GCGATTCACCAACAAAGATATCACTGCACAAATTATATCTGCCAGCATAG
CCGGGGATATAGTCCTTGCATCTGCTTATGCCCATGAGCTTCCCCGTTAT
GGTCTTGAGGTGGGCCTCACTAATTATGCAGCAGCTTATTGCACTGGACT
CCTCTTGGCCCGCCGAGTCCTGAAAATGCTTGAGATGGATGCTGAGTATG
AGGGGAACGTTGAGGCAACAGGAGAGGACTATTCAGTTGAGCCAACTGAG
AACAGGAGGCCTTTCCGTGCCCTGCTTGATGTTGGTCTTGTGAAAACAAC
TACTGGTAACCGTGTCTTTGGCGCTCTTAAGGGTGCATTGGATGGTGGAC
TTGATATCCCTCACAGTGAGAAGAGATTTGCTGGATTCAGTAAGGATAGT
AAGCAACTTGACGCTGAAGTTCACCGTAAATACATCTATTGTGGTCGTGT
CGCTGCCT
back to top