FC920407

Overview
NameFC920407
Unique NameFC920407
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length677
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig8317 contig Ccv1_Contig8317:4..680. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: MBK1_CAEEL (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 OS=Caenorhabditis elegans GN=mbk-1 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.535e-14
Identity = 41/115 (35.65%), Postives = 69/115 (60.00%), Query Frame = 1
Query:  337 DDREGHYVFNLGENLTPRYKILSK--MGEGTFGRVLECWDRQTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRNN 675
            DD+   Y+   GE    RY ILS   +G+G+FG+V + +D   +E VAIK++++ + + D A IEI +L+    +DK    + V ++  F +R H+C+VFE L  +L++ LK  +
Sbjct:  308 DDQNYDYILKNGEIFDKRYVILSDTPVGKGSFGQVTKAYDTLNKEEVAIKIIKNKKTFFDQAQIEIHLLELTNAHDKDNKYNIVTLKGHFVHRAHLCLVFELLSYNLYDLLKNTS 422          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: HIPK3_RAT (Homeodomain-interacting protein kinase 3 OS=Rattus norvegicus GN=Hipk3 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.005e-14
Identity = 37/94 (39.36%), Postives = 59/94 (62.77%), Query Frame = 1
Query:  391 YKILSKMGEGTFGRVLECWDRQTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRN 672
            Y++L  +G GTFG+V++CW R T E VAIK++++   Y     IE+ +L  L+  +     + V+    F +RNH C+VFE L  +L++FLK+N
Sbjct:  197 YEVLDFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLS-TENADEYNFVRAYECFQHRNHTCLVFEMLEQNLYDFLKQN 289          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: HIPK3_MOUSE (Homeodomain-interacting protein kinase 3 OS=Mus musculus GN=Hipk3 PE=1 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 2.005e-14
Identity = 37/94 (39.36%), Postives = 59/94 (62.77%), Query Frame = 1
Query:  391 YKILSKMGEGTFGRVLECWDRQTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRN 672
            Y++L  +G GTFG+V++CW R T E VAIK++++   Y     IE+ +L  L+  +     + V+    F +RNH C+VFE L  +L++FLK+N
Sbjct:  197 YEVLDFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLS-TENADEYNFVRAYECFQHRNHTCLVFEMLEQNLYDFLKQN 289          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: HIPK3_HUMAN (Homeodomain-interacting protein kinase 3 OS=Homo sapiens GN=HIPK3 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.005e-14
Identity = 37/94 (39.36%), Postives = 59/94 (62.77%), Query Frame = 1
Query:  391 YKILSKMGEGTFGRVLECWDRQTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRN 672
            Y++L  +G GTFG+V++CW R T E VAIK++++   Y     IE+ +L  L+  +     + V+    F +RNH C+VFE L  +L++FLK+N
Sbjct:  197 YEVLDFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLS-TENADEYNFVRAYECFQHRNHTCLVFEMLEQNLYDFLKQN 289          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: YAKA_DICDI (Probable serine/threonine-protein kinase yakA OS=Dictyostelium discoideum GN=yakA PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.618e-14
Identity = 43/130 (33.08%), Postives = 77/130 (59.23%), Query Frame = 1
Query:  313 HVSPPRRDDDREG---HYVFNLGENLT-----PRYKILSKMGEGTFGRVLECWDRQTQERVAIKVVRSIRKYRDAAMIEIDVLQHL-AKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRNN 675
            H S P  +D  +     Y+  + + +T      +YK+L  +G+GTFG+V++C +  T E VAIK++++ + Y     +EI  L+ L  ++D    +H +++ + F ++ H+CIVFE L  +LFE +K+NN
Sbjct:  171 HPSEPLSNDGYDNVNSDYIVYVNDIITNNESGQKYKVLDSLGQGTFGQVVKCKNCDTDELVAIKILKNKQAYFQQGRLEIQTLKSLNDQHDPEDKNHILRLLDSFIHKMHLCIVFELLSVNLFELIKQNN 300          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: PRP4_SCHPO (Serine/threonine-protein kinase prp4 OS=Schizosaccharomyces pombe GN=prp4 PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 5.833e-14
Identity = 38/111 (34.23%), Postives = 60/111 (54.05%), Query Frame = 1
Query:  337 DDREGHYVFNLGENLTPRYKILSKMGEGTFGRVLECWDRQTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKR 669
            DD EG+Y   L E L  RY + S +G+G F  V+   DR   +  AIK++R+        + E+ +L+ L   D+ G  H +     F ++NH+C+VFE L  +L + LK+
Sbjct:  141 DDIEGYYKVVLMEELDSRYIVQSNLGKGMFSTVVSALDRNRNQTFAIKIIRNNEVMYKEGLKEVSILERLQAADREGKQHIIHYERHFMHKNHLCMVFEMLSLNLRDILKK 251          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: PPK15_SCHPO (Serine/threonine-protein kinase ppk15 OS=Schizosaccharomyces pombe GN=ppk15 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.833e-14
Identity = 38/103 (36.89%), Postives = 66/103 (64.08%), Query Frame = 1
Query:  367 LGENLTPRYKILSKMGEGTFGRVLECWDRQTQERVAIKVVRSIRKYRDAAMIEIDVLQHL-AKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRN 672
            LG +   +Y IL  +G GTFG+V  C D +TQ+ VAIKV+++   + +  ++E+ +L+ L  K D     H +++ + F ++NH+C+VFE L  +L+E +K+N
Sbjct:  122 LGTDEGRKYLILDTLGHGTFGQVARCQDLKTQQIVAIKVIKNKPAFYNQCVMEVSILELLNNKYDPEDKRHLIRLYDQFMHKNHLCLVFELLSINLYELIKQN 224          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: YAK1_YEAST (Dual specificity protein kinase YAK1 OS=Saccharomyces cerevisiae GN=YAK1 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.938e-13
Identity = 38/103 (36.89%), Postives = 66/103 (64.08%), Query Frame = 1
Query:  367 LGENLTPRYKILSKMGEGTFGRVLECWDRQTQERVAIKVVRSIRKYRDAAMIEIDVLQHL-AKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRN 672
            LG     +Y +L  +G+GTFG+V++C +  T+E +A+KVV+S  +Y   ++ E  +L+ L  K D     H +++ + F ++NH+C+VFE L  +L+E LK+N
Sbjct:  361 LGVEQNRKYLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPTNKHHFLRMYDSFVHKNHLCLVFELLSNNLYELLKQN 463          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: PRP4B_RAT (Serine/threonine-protein kinase PRP4 homolog OS=Rattus norvegicus GN=Prpf4b PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.938e-13
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 1
Query:  319 SPPRRDD--DREGHYVFNLGENLTPRYKILSKMGEGTFGRVLECWDR-QTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKR 669
            +P  RD+  D EG+Y  N+GE L  RY +    G+G F  V+   D  +  + VA+K++R+    +   + E++ L+ L   D     HC+++   F ++ H+C+VFE L  +L E LK+
Sbjct:  661 NPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLKK 780          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: PRP4B_PONAB (Serine/threonine-protein kinase PRP4 homolog OS=Pongo abelii GN=PRPF4B PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.938e-13
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 1
Query:  319 SPPRRDD--DREGHYVFNLGENLTPRYKILSKMGEGTFGRVLECWDR-QTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKR 669
            +P  RD+  D EG+Y  N+GE L  RY +    G+G F  V+   D  +  + VA+K++R+    +   + E++ L+ L   D     HC+++   F ++ H+C+VFE L  +L E LK+
Sbjct:  661 NPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARASQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLKK 780          
The following BLAST results are available for this feature:
BLAST of FC920407 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 68
Match NameE-valueIdentityDescription
MBK1_CAEEL1.535e-1435.65Dual specificity tyrosine-phosphorylation-regulate... [more]
HIPK3_RAT2.005e-1439.36Homeodomain-interacting protein kinase 3 OS=Rattus... [more]
HIPK3_MOUSE2.005e-1439.36Homeodomain-interacting protein kinase 3 OS=Mus mu... [more]
HIPK3_HUMAN2.005e-1439.36Homeodomain-interacting protein kinase 3 OS=Homo s... [more]
YAKA_DICDI2.618e-1433.08Probable serine/threonine-protein kinase yakA OS=D... [more]
PRP4_SCHPO5.833e-1434.23Serine/threonine-protein kinase prp4 OS=Schizosacc... [more]
PPK15_SCHPO5.833e-1436.89Serine/threonine-protein kinase ppk15 OS=Schizosac... [more]
YAK1_YEAST4.938e-1336.89Dual specificity protein kinase YAK1 OS=Saccharomy... [more]
PRP4B_RAT4.938e-1332.50Serine/threonine-protein kinase PRP4 homolog OS=Ra... [more]
PRP4B_PONAB4.938e-1332.50Serine/threonine-protein kinase PRP4 homolog OS=Po... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H08EF RVDevelop1 Citrus clementina cDNA clone C32007H08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920407 ID=FC920407|Name=FC920407|organism=Citrus clementina|type=EST|length=677bp
ATCGTCACATTCGCCCAAAATATTCCCCCAATGCATAGGAACCCTAATTT
CCGAATGCTACCGTCATATCATCTCTCGCACTCTTATAATTCTGTTCGAA
TTTTCTACTAATATTCAAAACTATTGAGGAGTTTTGTGCTGCAGATACTT
AGGTTAAAAATCATACAAAGGAATAATAAATAGCAAACGATGATGGAGCA
GGAGCGAACCACTAAACGACGTCGGCTCGCTTGGGACGTGGCGCCATCGG
AGGCAGAGGCGCAACGGGCTCTGGTGGTGGGCCATGAAGGGGCTACGGCG
GCGGCTGCAAAACACGTGTCGCCGCCGAGAAGGGACGATGATCGTGAGGG
ACATTACGTTTTTAATCTCGGCGAAAATCTCACCCCCAGATATAAAATAC
TTAGCAAAATGGGTGAAGGCACATTTGGCCGTGTTTTGGAATGTTGGGAC
CGTCAAACACAGGAGCGTGTGGCAATCAAGGTAGTCAGAAGTATACGCAA
GTACCGTGATGCTGCAATGATTGAAATCGATGTTCTTCAGCATCTTGCTA
AAAATGACAAAGGCGGCAGCTCACATTGTGTGCAGATTCGAAATTGGTTT
GATTATCGCAATCATATTTGTATTGTGTTTGAGAAGCTTGGACCAAGTTT
ATTTGAATTTCTAAAGAGAAATAATAC
back to top