FC920412

Overview
NameFC920412
Unique NameFC920412
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length731
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14138 contig Ccv1_Contig14138:1..731. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_DEIPR (Chaperone protein dnaJ OS=Deinococcus proteolyticus GN=dnaJ PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.190e-16
Identity = 39/69 (56.52%), Postives = 53/69 (76.81%), Query Frame = 3
Query:  192 EYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSG 398
            +YY+VLGVS +AS+++IK AY   A++ HPDKN  D  AA+ F+ +GEAY VLSDP +RQAYD +G +G
Sbjct:    5 DYYEVLGVSRSASDSDIKSAYRKLAKQYHPDKNAGDESAAEKFKEIGEAYAVLSDPQKRQAYDQFGHTG 73          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_AZOVD (Chaperone protein dnaJ OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.190e-16
Identity = 45/101 (44.55%), Postives = 62/101 (61.39%), Query Frame = 3
Query:  192 EYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTE-----AIIDPAAIFAMLFGSELFEDYIG 479
            +YY+VLGV   A EAE+KKAY   A K HPD+NP+D  A + F+ + EAY+VLSD  +R AYD YG +G+              A F+ +FG ++F D+ G
Sbjct:    5 DYYEVLGVERGAGEAELKKAYRRLAMKYHPDRNPDDKSAEEKFKEVNEAYEVLSDAGKRMAYDQYGHAGVDQSMGGGAGFGAGGANFSDIFG-DVFSDFFG 104          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_METFK (Chaperone protein dnaJ OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 5.473e-16
Identity = 46/100 (46.00%), Postives = 63/100 (63.00%), Query Frame = 3
Query:  192 EYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAA----IFAMLFGSELFEDYIG 479
            +YY+VLGV+  A++ EIKKAY   A K HPD+NP++P A ++F+   EAY+VLSD  +R AYD YG +G+   A     A     FA  FG ++F D  G
Sbjct:    5 DYYEVLGVNRDATDEEIKKAYRKLAMKYHPDRNPDNPKAEEHFKEAKEAYEVLSDDQKRAAYDQYGHAGVDPSAAAGAGAGGFGNFADAFG-DIFGDIFG 103          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_HALHL (Chaperone protein dnaJ OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 5.473e-16
Identity = 39/74 (52.70%), Postives = 54/74 (72.97%), Query Frame = 3
Query:  192 EYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEA 413
            +YY+VLGV+  AS+AEIKKAY   A+K HPD+NP D  +A+ F+ + EAY+VLSD  +R AYD +G +G+   A
Sbjct:    5 DYYEVLGVNKNASDAEIKKAYRRMAQKFHPDRNPGDEESAERFKEVKEAYEVLSDAQKRAAYDQFGHAGVDPSA 78          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_CHLPN (Chaperone protein dnaJ OS=Chlamydia pneumoniae GN=dnaJ PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 5.473e-16
Identity = 39/69 (56.52%), Postives = 49/69 (71.01%), Query Frame = 3
Query:  192 EYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSG 398
            +YY +LG+S TAS  EIKKAY   A K HPDKNP D  A + F+ + EAY+VLSDP +R +YD +GK G
Sbjct:    2 DYYSILGISKTASAEEIKKAYRKLAVKYHPDKNPGDAAAEKRFKEVSEAYEVLSDPQKRDSYDRFGKDG 70          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNJA1_RAT (DnaJ homolog subfamily A member 1 OS=Rattus norvegicus GN=Dnaja1 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 7.148e-16
Identity = 46/96 (47.92%), Postives = 59/96 (61.46%), Query Frame = 3
Query:  177 MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYG----KSGISTEAIIDPAAIFAMLFG 452
            MVKET YYDVLGV P A++ E+KKAY   A K HPDKNPN+    + F+ + +AY+VL+D  +R+ YD  G    K G +      P  IF M FG
Sbjct:    1 MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNE---GEKFKQISQAYEVLADSKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFG 93          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNJA1_MOUSE (DnaJ homolog subfamily A member 1 OS=Mus musculus GN=Dnaja1 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 7.148e-16
Identity = 46/96 (47.92%), Postives = 59/96 (61.46%), Query Frame = 3
Query:  177 MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYG----KSGISTEAIIDPAAIFAMLFG 452
            MVKET YYDVLGV P A++ E+KKAY   A K HPDKNPN+    + F+ + +AY+VL+D  +R+ YD  G    K G +      P  IF M FG
Sbjct:    1 MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNE---GEKFKQISQAYEVLADSKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFG 93          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_PSEST (Chaperone protein dnaJ OS=Pseudomonas stutzeri GN=dnaJ PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 7.148e-16
Identity = 44/98 (44.90%), Postives = 59/98 (60.20%), Query Frame = 3
Query:  192 EYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQL 485
            ++Y+VLGV   ASEAE+KKAY   A K HPD+NP D  A + F+   EAY+VLSDP++R AYD YG +G+  +     A      +G   F D  G +
Sbjct:    5 DFYEVLGVERGASEAELKKAYRRLAMKHHPDRNPGDKAAEEAFKEANEAYEVLSDPSKRAAYDQYGHAGVDPQM---GAGAGGAGYGGANFSDIFGDV 99          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_PORGI (Chaperone protein dnaJ OS=Porphyromonas gingivalis GN=dnaJ PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 7.148e-16
Identity = 39/79 (49.37%), Postives = 55/79 (69.62%), Query Frame = 3
Query:  177 MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEA 413
            M ++ +YY+VLGVS  A++ E+KKAY  KA + HPDKNP D  A ++F+ + EAY VLSDP +R  YD +G +G+   A
Sbjct:    1 MAEKRDYYEVLGVSKNATDDELKKAYRKKAIQYHPDKNPGDKEAEEHFKEVAEAYDVLSDPQKRSQYDQFGHAGLGGAA 79          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_PORG3 (Chaperone protein dnaJ OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 7.148e-16
Identity = 39/79 (49.37%), Postives = 55/79 (69.62%), Query Frame = 3
Query:  177 MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEA 413
            M ++ +YY+VLGVS  A++ E+KKAY  KA + HPDKNP D  A ++F+ + EAY VLSDP +R  YD +G +G+   A
Sbjct:    1 MAEKRDYYEVLGVSKNATDDELKKAYRKKAIQYHPDKNPGDKEAEEHFKEVAEAYDVLSDPEKRSRYDQFGHAGLGGAA 79          
The following BLAST results are available for this feature:
BLAST of FC920412 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAJ_DEIPR4.190e-1656.52Chaperone protein dnaJ OS=Deinococcus proteolyticu... [more]
DNAJ_AZOVD4.190e-1644.55Chaperone protein dnaJ OS=Azotobacter vinelandii (... [more]
DNAJ_METFK5.473e-1646.00Chaperone protein dnaJ OS=Methylobacillus flagella... [more]
DNAJ_HALHL5.473e-1652.70Chaperone protein dnaJ OS=Halorhodospira halophila... [more]
DNAJ_CHLPN5.473e-1656.52Chaperone protein dnaJ OS=Chlamydia pneumoniae GN=... [more]
DNJA1_RAT7.148e-1647.92DnaJ homolog subfamily A member 1 OS=Rattus norveg... [more]
DNJA1_MOUSE7.148e-1647.92DnaJ homolog subfamily A member 1 OS=Mus musculus ... [more]
DNAJ_PSEST7.148e-1644.90Chaperone protein dnaJ OS=Pseudomonas stutzeri GN=... [more]
DNAJ_PORGI7.148e-1649.37Chaperone protein dnaJ OS=Porphyromonas gingivalis... [more]
DNAJ_PORG37.148e-1649.37Chaperone protein dnaJ OS=Porphyromonas gingivalis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008A07EF RVDevelop1 Citrus clementina cDNA clone C32008A07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920412 ID=FC920412|Name=FC920412|organism=Citrus clementina|type=EST|length=731bp
GGAAGGAATCAGAGGTCAGCGCGCGGGAGAGTAAATCTGCTTTCATCCTT
TTTGTATGCTCTATTCTATCTGTTATCTTTCTGAATCTGCTTCGTAACTA
ATCAGTTTGATTTAGATTGTAAATCGAAGAAAGCTAAGCTAGACTAGTAG
TAATTTTCGGGTCTTGAGAATCAGTGATGGTTAAGGAGACGGAATATTAC
GACGTCCTAGGCGTCAGCCCAACGGCTTCGGAGGCCGAGATCAAGAAAGC
TTACTACATCAAGGCACGTAAGGTTCACCCTGATAAAAACCCAAATGATC
CTCTTGCTGCTCAAAATTTTCAGGTTTTGGGAGAGGCTTACCAGGTATTG
AGTGATCCAGCCCAACGGCAAGCATATGATGCTTATGGGAAATCAGGAAT
CTCAACTGAAGCAATTATTGATCCTGCAGCAATCTTCGCGATGCTTTTTG
GAAGTGAGCTTTTTGAGGATTATATAGGTCAGCTTGCCATGGCTTCAGTG
GCTTCTCTAGACATTTTCACTGAAGGGGAAGAGTTTGATGCTAAAAAGTT
GCAAGACAAAATGAAGGTTGTTCAGAAGGAAAGGGAGGAAAAACTTGCAG
ATATACTAAGAGGTCGACTCAACCAATATGTACAAGGGAAACAAGAGGAT
TTCATTAATTATGCTGAAGCTGAAGTTTCAAGGCTGTCTAATGCTGCGTA
TGGTGGTGATATGNTGAATACAATTGGCTAT
back to top