FC920412

Overview
NameFC920412
Unique NameFC920412
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length731
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14138 contig Ccv1_Contig14138:1..731. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_BURM7 (Chaperone protein dnaJ OS=Burkholderia mallei (strain NCTC 10247) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.348e-14
Identity = 46/102 (45.10%), Postives = 62/102 (60.78%), Query Frame = 3
Query:  192 EYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTE---AIIDPAAIFAMLFGSELFEDYIGQLA 488
            +YY+VLGV+  AS+ EIKKAY   A K HPD+NP+   A ++F+   EAY++LSD  +R AYD YG +G+      A       FA  FG ++F D  GQ A
Sbjct:    5 DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDGQKRAAYDQYGHAGVDPNVGAAGAQGFGGFADAFG-DIFGDIFGQAA 105          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_BURCJ (Chaperone protein dnaJ OS=Burkholderia cepacia (strain J2315 / LMG 16656) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.348e-14
Identity = 46/102 (45.10%), Postives = 62/102 (60.78%), Query Frame = 3
Query:  192 EYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTE---AIIDPAAIFAMLFGSELFEDYIGQLA 488
            +YY+VLGV+  AS+ EIKKAY   A K HPD+NP+   A ++F+   EAY++LSD  +R AYD YG +G+      A       FA  FG ++F D  GQ A
Sbjct:    5 DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDGQKRAAYDQYGHAGVDPNMGGAGAQGFGGFADAFG-DIFGDIFGQAA 105          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_BURCH (Chaperone protein dnaJ OS=Burkholderia cenocepacia (strain HI2424) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.348e-14
Identity = 46/102 (45.10%), Postives = 62/102 (60.78%), Query Frame = 3
Query:  192 EYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTE---AIIDPAAIFAMLFGSELFEDYIGQLA 488
            +YY+VLGV+  AS+ EIKKAY   A K HPD+NP+   A ++F+   EAY++LSD  +R AYD YG +G+      A       FA  FG ++F D  GQ A
Sbjct:    5 DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDGQKRAAYDQYGHAGVDPNMGGAGAQGFGGFADAFG-DIFGDIFGQAA 105          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_BURCC (Chaperone protein dnaJ OS=Burkholderia cenocepacia (strain MC0-3) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.348e-14
Identity = 46/102 (45.10%), Postives = 62/102 (60.78%), Query Frame = 3
Query:  192 EYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTE---AIIDPAAIFAMLFGSELFEDYIGQLA 488
            +YY+VLGV+  AS+ EIKKAY   A K HPD+NP+   A ++F+   EAY++LSD  +R AYD YG +G+      A       FA  FG ++F D  GQ A
Sbjct:    5 DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDGQKRAAYDQYGHAGVDPNMGGAGAQGFGGFADAFG-DIFGDIFGQAA 105          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_BURCA (Chaperone protein dnaJ OS=Burkholderia cenocepacia (strain AU 1054) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.348e-14
Identity = 46/102 (45.10%), Postives = 62/102 (60.78%), Query Frame = 3
Query:  192 EYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTE---AIIDPAAIFAMLFGSELFEDYIGQLA 488
            +YY+VLGV+  AS+ EIKKAY   A K HPD+NP+   A ++F+   EAY++LSD  +R AYD YG +G+      A       FA  FG ++F D  GQ A
Sbjct:    5 DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDGQKRAAYDQYGHAGVDPNMGGAGAQGFGGFADAFG-DIFGDIFGQAA 105          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_BACTN (Chaperone protein dnaJ OS=Bacteroides thetaiotaomicron GN=dnaJ PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.348e-14
Identity = 39/79 (49.37%), Postives = 53/79 (67.09%), Query Frame = 3
Query:  177 MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEA 413
            M ++ +YY+VL V+ TA+  EIKKAY  KA + HPDKNP D  A + F+   EAY VLS+P +R  YD +G +G+S  A
Sbjct:    1 MAEKRDYYEVLEVTKTATVEEIKKAYRKKAIQYHPDKNPGDKEAEEKFKEAAEAYDVLSNPDKRSRYDQFGHAGVSGAA 79          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNJB4_MOUSE (DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.761e-14
Identity = 48/132 (36.36%), Postives = 72/132 (54.55%), Query Frame = 3
Query:  192 EYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEA--------------IIDPAAIFAMLF-GSELFEDYIGQLAMASVASLDIFTEGEEFDA 542
            +YY +LG+   A++ ++KKAY  +A K HPDKN + P A + F+ + EAY+VLSDP +R+ YD +G+ G+   A                DP A FA  F GS  FE + G+       S ++  +G+ F A
Sbjct:    4 DYYHILGIDKGATDEDVKKAYRKQALKFHPDKNKS-PQAEEKFKEVAEAYEVLSDPKKREIYDQFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSA 134          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_RHILE (Chaperone protein dnaJ (Fragment) OS=Rhizobium leguminosarum GN=dnaJ PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.761e-14
Identity = 39/100 (39.00%), Postives = 60/100 (60.00%), Query Frame = 3
Query:  186 ETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQL 485
            + ++Y+ LGV+ +A E E+K A+   A K HPDKNP+D  A + F+ + EAY++L DP +R AYD YG +      +      FA    S++FED  G++
Sbjct:    3 KADFYETLGVAKSADEKELKSAFRKLAMKFHPDKNPDDKDAERKFKEINEAYEMLKDPQKRAAYDRYGHAAFEHGGMGGGGGGFAGGGFSDIFEDIFGEM 102          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_RHIL3 (Chaperone protein dnaJ OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.761e-14
Identity = 39/100 (39.00%), Postives = 60/100 (60.00%), Query Frame = 3
Query:  186 ETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQL 485
            + ++Y+ LGV+ +A E E+K A+   A K HPDKNP+D  A + F+ + EAY++L DP +R AYD YG +      +      FA    S++FED  G++
Sbjct:    3 KADFYETLGVAKSADEKELKSAFRKLAMKYHPDKNPDDKDAERKFKEINEAYEMLKDPQKRAAYDRYGHAAFEHGGMGGGGGGFAGGGFSDIFEDIFGEM 102          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_RHIE6 (Chaperone protein dnaJ OS=Rhizobium etli (strain CIAT 652) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.761e-14
Identity = 39/100 (39.00%), Postives = 60/100 (60.00%), Query Frame = 3
Query:  186 ETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQL 485
            + ++Y+ LGV+ +A E E+K A+   A K HPDKNP+D  A + F+ + EAY++L DP +R AYD YG +      +      FA    S++FED  G++
Sbjct:    3 KADFYETLGVAKSADEKELKSAFRKLAMKYHPDKNPDDKDAERKFKEINEAYEMLKDPQKRAAYDRYGHAAFEHGGMGGGGGGFAGGGFSDIFEDIFGEM 102          
The following BLAST results are available for this feature:
BLAST of FC920412 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAJ_BURM71.348e-1445.10Chaperone protein dnaJ OS=Burkholderia mallei (str... [more]
DNAJ_BURCJ1.348e-1445.10Chaperone protein dnaJ OS=Burkholderia cepacia (st... [more]
DNAJ_BURCH1.348e-1445.10Chaperone protein dnaJ OS=Burkholderia cenocepacia... [more]
DNAJ_BURCC1.348e-1445.10Chaperone protein dnaJ OS=Burkholderia cenocepacia... [more]
DNAJ_BURCA1.348e-1445.10Chaperone protein dnaJ OS=Burkholderia cenocepacia... [more]
DNAJ_BACTN1.348e-1449.37Chaperone protein dnaJ OS=Bacteroides thetaiotaomi... [more]
DNJB4_MOUSE1.761e-1436.36DnaJ homolog subfamily B member 4 OS=Mus musculus ... [more]
DNAJ_RHILE1.761e-1439.00Chaperone protein dnaJ (Fragment) OS=Rhizobium leg... [more]
DNAJ_RHIL31.761e-1439.00Chaperone protein dnaJ OS=Rhizobium leguminosarum ... [more]
DNAJ_RHIE61.761e-1439.00Chaperone protein dnaJ OS=Rhizobium etli (strain C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008A07EF RVDevelop1 Citrus clementina cDNA clone C32008A07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920412 ID=FC920412|Name=FC920412|organism=Citrus clementina|type=EST|length=731bp
GGAAGGAATCAGAGGTCAGCGCGCGGGAGAGTAAATCTGCTTTCATCCTT
TTTGTATGCTCTATTCTATCTGTTATCTTTCTGAATCTGCTTCGTAACTA
ATCAGTTTGATTTAGATTGTAAATCGAAGAAAGCTAAGCTAGACTAGTAG
TAATTTTCGGGTCTTGAGAATCAGTGATGGTTAAGGAGACGGAATATTAC
GACGTCCTAGGCGTCAGCCCAACGGCTTCGGAGGCCGAGATCAAGAAAGC
TTACTACATCAAGGCACGTAAGGTTCACCCTGATAAAAACCCAAATGATC
CTCTTGCTGCTCAAAATTTTCAGGTTTTGGGAGAGGCTTACCAGGTATTG
AGTGATCCAGCCCAACGGCAAGCATATGATGCTTATGGGAAATCAGGAAT
CTCAACTGAAGCAATTATTGATCCTGCAGCAATCTTCGCGATGCTTTTTG
GAAGTGAGCTTTTTGAGGATTATATAGGTCAGCTTGCCATGGCTTCAGTG
GCTTCTCTAGACATTTTCACTGAAGGGGAAGAGTTTGATGCTAAAAAGTT
GCAAGACAAAATGAAGGTTGTTCAGAAGGAAAGGGAGGAAAAACTTGCAG
ATATACTAAGAGGTCGACTCAACCAATATGTACAAGGGAAACAAGAGGAT
TTCATTAATTATGCTGAAGCTGAAGTTTCAAGGCTGTCTAATGCTGCGTA
TGGTGGTGATATGNTGAATACAATTGGCTAT
back to top