FC920414

Overview
NameFC920414
Unique NameFC920414
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length738
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14139 contig Ccv1_Contig14139:1..740. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UGDH_CAEEL (UDP-glucose 6-dehydrogenase OS=Caenorhabditis elegans GN=sqv-4 PE=1 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 4.485e-68
Identity = 124/206 (60.19%), Postives = 156/206 (75.73%), Query Frame = 3
Query:   72 KMVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTH---NSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPED 680
            K+ K+ C+GAGYVGGPT A+IA KCP I V VVD++ ++I  WNSD+LPIYEPGLD +V   RG+NLFFS+D+ K ++EAD++F+SVNTPTK  G G G A DL Y ES +R IA  +   KIVVEKSTVPVK AE+I  IL     N++ +KFQ+LSNPEFLAEGTA++DL NPDRVLIGG  +PEG +AV  L  +Y +WVP +
Sbjct:    8 KVSKVVCVGAGYVGGPTCAMIAHKCPHITVTVVDMNTAKIAEWNSDKLPIYEPGLDEIVFAARGRNLFFSSDIPKAIAEADLIFISVNTPTKMYGRGKGMAPDLKYVESVSRTIAQYAGGPKIVVEKSTVPVKAAESIGCILREAQKNNENLKFQVLSNPEFLAEGTAMKDLANPDRVLIGGESSPEGLQAVAELVRIYENWVPRN 213          

HSP 2 Score: 28.8758 bits (63), Expect = 4.485e-68
Identity = 12/15 (80.00%), Postives = 13/15 (86.67%), Query Frame = 1
Query:  694 NLWSAELSKLAANAF 738
            N WS+ELSKL ANAF
Sbjct:  219 NTWSSELSKLVANAF 233          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: TUAD_BACSU (UDP-glucose 6-dehydrogenase tuaD OS=Bacillus subtilis GN=tuaD PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.129e-26
Identity = 74/182 (40.66%), Postives = 102/182 (56.04%), Query Frame = 3
Query:   75 MVKICCIGAGYVG---GPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGL-DGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKG-IKFQILSNPEFLAEGTAIQDLFNPDRVLIG 605
            M KI  IG GYVG   G   A I  K     V   DI  S+I +  +  +PIYEPGL D V K    + L F+ D+   +  +DI++++V TP    G      ADLTY ++AA+ I +     K++V KSTVPV T + ++ I+   SKG   F ++SNPEFL EG+AI D  N +R +IG
Sbjct:    1 MKKIAVIGTGYVGLVSGTCFAEIGNK-----VVCCDIDESKIRSLKNGVIPIYEPGLADLVEKNVLDQRLTFTNDIPSAIRASDIIYIAVGTPMSKTG-----EADLTYVKAAAKTIGEHLNGYKVIVNKSTVPVGTGKLVQSIVQKASKGRYSFDVVSNPEFLREGSAIHDTMNMERAVIG 172          

HSP 2 Score: 23.0978 bits (48), Expect = 1.129e-26
Identity = 11/15 (73.33%), Postives = 12/15 (80.00%), Query Frame = 1
Query:  694 NLWSAELSKLAANAF 738
            NL SAE+ K AANAF
Sbjct:  197 NLESAEMIKYAANAF 211          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: Y1054_METJA (Uncharacterized protein MJ1054 OS=Methanocaldococcus jannaschii GN=MJ1054 PE=3 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.320e-25
Identity = 72/199 (36.18%), Postives = 115/199 (57.79%), Query Frame = 3
Query:   78 VKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIAD-VSKSD-KIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHW 668
            + I  IG GYVG   +  + L     +V  +DI  S++ A N  + P+YE GL+G++K+   KNL F+T   K + ++D++F+ V TP    G      ADL +  SA   I + + K D K++V KSTVPV T   ++++L    K     ++SNPEFL EG A+ D FNP+RV++ G E    +K ++ +++VY ++
Sbjct:    1 MNISVIGTGYVG--LIQAVGLAEFGFDVVGIDIDESKVKALNRGECPLYEEGLEGLLKKHVNKNLTFTTSY-KPIKDSDVIFLCVGTPQDKDG-----NADLRFLFSAVEKIKETIDKEDYKVIVIKSTVPVGTNRRVKELL----KDYNVDVVSNPEFLREGIAVYDFFNPERVIL-GFENLNNKKPIEIMEEVYKYF 186          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UDG_PSEAE (UDP-glucose 6-dehydrogenase OS=Pseudomonas aeruginosa GN=udg PE=3 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 1.320e-25
Identity = 74/207 (35.75%), Postives = 114/207 (55.07%), Query Frame = 3
Query:   78 VKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVK-QCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKI----LTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDE 683
            +++C IGAGYVG  T A  A      +V  V+    R+      ++PIYEPGL+ +++ Q     L F+  + + +++A++VF++V TP    G     +ADL++  + A  +    +   IVV KSTVPV TAE +E+I    L    K  +  + SNPEFL EG+A+ D   PDRV+IG  ET  G+     L+ +YA ++   E
Sbjct:    1 MRLCVIGAGYVGLVTAACFAEM--GNQVRCVERDRERVARLRRGEMPIYEPGLESILRDQLDAARLTFTASLAEGLADAEVVFIAVGTPCGEDG-----SADLSHVLAVAEQLGAQLRQACIVVNKSTVPVGTAERVEEIIRLGLARRRKRFRVAVASNPEFLKEGSAVDDFRRPDRVIIGSAETQAGE----TLRQLYAPFLRNHE 196          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UDG_RHIME (UDP-glucose 6-dehydrogenase OS=Rhizobium meliloti GN=rkpK PE=3 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 2.251e-25
Identity = 71/177 (40.11%), Postives = 105/177 (59.32%), Query Frame = 3
Query:   78 VKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVV-KQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIG 605
            +KI  IGAGYVG   ++ +       +V  VD    +I+A    Q+PI+EPGLD +V        L F+ D++  V+ +D+VF++V TP++    G G A DL+Y  +AAR IA   +   +VV KSTVPV T + +E+I+   +      ++SNPEFL EG AI+D   PDR++IG
Sbjct:    1 MKITMIGAGYVG--LVSGVCFADFGHDVVCVDKDEGKISALKKGQIPIFEPGLDHLVASNVASGRLNFTDDLKTAVAASDVVFIAVGTPSRR---GDGHA-DLSYVYAAAREIAANLQGFTVVVTKSTVPVGTGDEVERIIRETNPAADVTVVSNPEFLREGAAIEDFKRPDRIVIG 171          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: YTCA_BACSU (Putative UDP-glucose 6-dehydrogenase ytcA OS=Bacillus subtilis GN=ytcA PE=3 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.489e-24
Identity = 71/198 (35.86%), Postives = 109/198 (55.05%), Query Frame = 3
Query:   78 VKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHN--SKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAH 665
            +KIC +GAGYVG    A  AL     ++   D  V +I       +P YEPGL   + +C   NL FS++V+  + E  ++F++V TP ++ G     +AD    +S    +++  +S K ++ KSTVP  T E I K L  +  SK + F I+SNPEFL EG A+ D+ +PD+ +IG +E  E   +   +K +Y H
Sbjct:    1 MKICVVGAGYVGLTLSA--ALASIGHDMICTDKDVKKIGQLKKGVIPFYEPGLSDAILRCG--NLSFSSEVKSSMEECPVIFIAVGTPPRSDG-----SADTKALQSVIGDLSEAIRSYKTIITKSTVPPGTNENIAKQLIASGVSKNL-FNIVSNPEFLREGNALYDMLHPDKTVIGVQE--EDHVSAAIVKSIYKH 186          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: YWQF_BACSU (UDP-glucose 6-dehydrogenase ywqF OS=Bacillus subtilis GN=ywqF PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 9.458e-24
Identity = 71/196 (36.22%), Postives = 109/196 (55.61%), Query Frame = 3
Query:   78 VKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVV-KQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILT-HNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVY 659
            + I  IG GYVG   +  ++L      V  +DI   +I+       PI+EPGL+ ++ K      L F T  EK +++ADI+F++V TP K+ G      A+L     AA+ IA   K D +VV KSTVPV T + I  ++T H ++ +   + SNPEFL EG+AI D F+ DR++IG  +    +K    L++++
Sbjct:    1 MNITVIGTGYVG--LVTGVSLSEIGHHVTCIDIDAHKIDEMRKGISPIFEPGLEELMRKNTADGRLNFETSYEKGLAQADIIFIAVGTPQKSDG-----HANLEQITDAAKRIAKHVKRDTVVVTKSTVPVGTNDLINGLITEHLAEPVSISVASNPEFLREGSAIYDTFHGDRIVIGTAD----EKTANTLEELF 185          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UDG_RICFE (UDP-glucose 6-dehydrogenase OS=Rickettsia felis GN=udg PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.846e-19
Identity = 66/196 (33.67%), Postives = 101/196 (51.53%), Query Frame = 3
Query:   78 VKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKN-LFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYA 662
            + I  IG+GYVG   ++ I +      V  +D    +I+  N   LPIYE  LD  +KQ    N L F+      +  A+ +F++V TP+K  G      ADL Y   A   +++    D ++V KSTVP  +   I   L   SKG  F + SNPEFL EG+A++D   PDR+++G       +++ + L+ +YA
Sbjct:    1 MNITFIGSGYVG--LVSGIIMGYLGHNVTCLDNDEVKISKLNKQILPIYEAKLDEYLKQALEANRLKFTNIYNNELQNAEAIFITVGTPSKESG-----EADLKYVYDAIDKVSEHINKDCLIVIKSTVPPDSCSNIIAYL--KSKGFSFNVASNPEFLREGSAVEDFLYPDRIVVG----VNNKESEEILRKIYA 183          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UDG_RICCN (UDP-glucose 6-dehydrogenase OS=Rickettsia conorii GN=udg PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 9.161e-19
Identity = 68/196 (34.69%), Postives = 100/196 (51.02%), Query Frame = 3
Query:   78 VKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQC-RGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYA 662
            + I  IG+GYVG   ++ I +      V  +D    +I+  N   LPIYE  LD  +KQ      L F+      +  AD +F++V TP+K  GLG    ADL Y   A   + +    D ++V KSTVP  +   I   L   S+G  F + SNPEFL EG+A++D   PDR++IG       +++   L+ +YA
Sbjct:    1 MNITFIGSGYVG--LVSGIIMGYLGHNVTCLDNDEVKISKLNKQILPIYEAKLDEYLKQALESDRLKFTNIYNNELQNADAIFITVGTPSK--GLGE---ADLKYVYDAIDKVFEHINKDCLIVIKSTVPPGSCSNIIAYL--KSRGFSFNVASNPEFLREGSAVEDFLYPDRIVIG----VNNKESEAILRKIYA 183          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UDG_RICTY (UDP-glucose 6-dehydrogenase OS=Rickettsia typhi GN=udg PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.013e-17
Identity = 66/196 (33.67%), Postives = 95/196 (48.47%), Query Frame = 3
Query:   78 VKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQC-RGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYA 662
            + I  IG+GYVG   ++ I +      V   D    +I+  N   LPIYE  LD  +KQ      L F+          D VF++V TP+K  G      ADL Y   A   ++     D ++V KSTVP  +   I   L   +KG  F + SNPEFL EG+A++D   PDR+++G       Q++   L+ +YA
Sbjct:    1 MNITFIGSGYVG--LVSGIIMGYLGHNVTCFDNDDVKISKLNKKILPIYEAKLDEYLKQALESDRLKFTNIYSNDFRNVDAVFITVGTPSKELG-----EADLKYVYDAVDKVSKHINKDCLIVIKSTVPPGSCNNIIAYL--KAKGFSFNVASNPEFLREGSAVEDFLYPDRIVVG----VNNQESEALLRTIYA 183          
The following BLAST results are available for this feature:
BLAST of FC920414 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 38
Match NameE-valueIdentityDescription
UGDH_CAEEL4.485e-6860.19UDP-glucose 6-dehydrogenase OS=Caenorhabditis eleg... [more]
TUAD_BACSU1.129e-2640.66UDP-glucose 6-dehydrogenase tuaD OS=Bacillus subti... [more]
Y1054_METJA1.320e-2536.18Uncharacterized protein MJ1054 OS=Methanocaldococc... [more]
UDG_PSEAE1.320e-2535.75UDP-glucose 6-dehydrogenase OS=Pseudomonas aerugin... [more]
UDG_RHIME2.251e-2540.11UDP-glucose 6-dehydrogenase OS=Rhizobium meliloti ... [more]
YTCA_BACSU2.489e-2435.86Putative UDP-glucose 6-dehydrogenase ytcA OS=Bacil... [more]
YWQF_BACSU9.458e-2436.22UDP-glucose 6-dehydrogenase ywqF OS=Bacillus subti... [more]
UDG_RICFE1.846e-1933.67UDP-glucose 6-dehydrogenase OS=Rickettsia felis GN... [more]
UDG_RICCN9.161e-1934.69UDP-glucose 6-dehydrogenase OS=Rickettsia conorii ... [more]
UDG_RICTY1.013e-1733.67UDP-glucose 6-dehydrogenase OS=Rickettsia typhi GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008A11EF RVDevelop1 Citrus clementina cDNA clone C32008A11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920414 ID=FC920414|Name=FC920414|organism=Citrus clementina|type=EST|length=738bp
GATCGTTGTAGAAACAGTTGTTTTGATTTTGAGAAATCGAAGCTCACTGA
GGTTATATTGATTAGTAAAGGAAAATGGTGAAGATCTGCTGCATCGGTGC
TGGGTATGTTGGGGGGCCGACAATGGCAGTCATTGCACTGAAGTGCCCAT
CCATTGAAGTGGCTGTTGTTGATATCTCTGTGTCTCGGATCAATGCCTGG
AACAGTGACCAGCTCCCCATCTATGAGCCTGGACTTGATGGTGTGGTAAA
GCAGTGCCGAGGGAAGAACCTGTTCTTCAGCACCGATGTTGAGAAGCATG
TCTCTGAGGCTGATATTGTCTTTGTTTCGGTCAATACCCCAACTAAAACT
CAGGGTCTTGGTGCTGGCAAAGCTGCAGATCTGACATACTGGGAGAGCGC
TGCTCGTGTGATTGCCGATGTGTCAAAGTCTGACAAAATTGTTGTTGAGA
AATCAACAGTTCCTGTAAAAACTGCTGAGGCAATTGAAAAAATTTTGACC
CACAACAGCAAGGGAATCAAATTCCAGATCCTTTCAAACCCGGAGTTTCT
TGCTGAGGGAACTGCAATACAGGATCTTTTTAACCCAGATCGGGTCCTTA
TCGGTGGTAGAGAAACGCCAGAAGGCCAGAAAGCCGTCAAAGCCTTGAAG
GATGTGTATGCACACTGGGTCCCAGAAGACGAATTTTGACCACAACCTCT
GGTCTGCAGAGCTTTCGAAGCTTGCAGCCAATGCTTTC
back to top