FC920417

Overview
NameFC920417
Unique NameFC920417
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length680
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC920417_ssr32 microsatellite FC920417_ssr32:32..59. BLAST: Citrus ESTs to Prunus persica proteins V1
FC920417_ssr210 microsatellite FC920417_ssr210:210..219. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: RO32_XENLA (Heterogeneous nuclear ribonucleoprotein A3 homolog 2 OS=Xenopus laevis PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.734e-11
Identity = 33/85 (38.82%), Postives = 54/85 (63.53%), Query Frame = 3
Query:  414 KKLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAE-HFLGSRMLEVKIATPKEEMRAP 665
            +KL + G+ ++   D LRE+  ++G L DCVVM++  T RSRGFG+VT++  E+   ++SA  H +  R++E K A  +E+   P
Sbjct:   27 RKLFIGGLSFETTDDSLREHFEQWGKLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDASMSARPHKVDGRVVEPKRAVSREDSARP 111          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: RO31_XENLA (Heterogeneous nuclear ribonucleoprotein A3 homolog 1 OS=Xenopus laevis PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.734e-11
Identity = 33/85 (38.82%), Postives = 54/85 (63.53%), Query Frame = 3
Query:  414 KKLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAE-HFLGSRMLEVKIATPKEEMRAP 665
            +KL + G+ ++   D LRE+  ++G L DCVVM++  T RSRGFG+VT++  E+   ++SA  H +  R++E K A  +E+   P
Sbjct:   27 RKLFIGGLSFETTDDSLREHFEQWGKLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDASMSARPHKVDGRVVEPKRAVSREDSARP 111          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: ROA1_RAT (Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus GN=Hnrnpa1 PE=1 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 3.570e-11
Identity = 32/85 (37.65%), Postives = 56/85 (65.88%), Query Frame = 3
Query:  414 KKLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAE-HFLGSRMLEVKIATPKEEMRAP 665
            +KL + G+ ++   + LR +  ++G L DCVVM++ +T RSRGFG+VT+A+ E+   A++A  H +  R++E K A  +E+ + P
Sbjct:   14 RKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRP 98          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: ROA1_PANTR (Heterogeneous nuclear ribonucleoprotein A1 OS=Pan troglodytes GN=HNRNPA1 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.570e-11
Identity = 32/85 (37.65%), Postives = 56/85 (65.88%), Query Frame = 3
Query:  414 KKLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAE-HFLGSRMLEVKIATPKEEMRAP 665
            +KL + G+ ++   + LR +  ++G L DCVVM++ +T RSRGFG+VT+A+ E+   A++A  H +  R++E K A  +E+ + P
Sbjct:   14 RKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRP 98          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: ROA1_MOUSE (Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus GN=Hnrnpa1 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 3.570e-11
Identity = 32/85 (37.65%), Postives = 56/85 (65.88%), Query Frame = 3
Query:  414 KKLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAE-HFLGSRMLEVKIATPKEEMRAP 665
            +KL + G+ ++   + LR +  ++G L DCVVM++ +T RSRGFG+VT+A+ E+   A++A  H +  R++E K A  +E+ + P
Sbjct:   14 RKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRP 98          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: ROA1_HUMAN (Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5)

HSP 1 Score: 68.5514 bits (166), Expect = 3.570e-11
Identity = 32/85 (37.65%), Postives = 56/85 (65.88%), Query Frame = 3
Query:  414 KKLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAE-HFLGSRMLEVKIATPKEEMRAP 665
            +KL + G+ ++   + LR +  ++G L DCVVM++ +T RSRGFG+VT+A+ E+   A++A  H +  R++E K A  +E+ + P
Sbjct:   14 RKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRP 98          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: ROA1_BOVIN (Heterogeneous nuclear ribonucleoprotein A1 OS=Bos taurus GN=HNRNPA1 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 3.570e-11
Identity = 32/85 (37.65%), Postives = 56/85 (65.88%), Query Frame = 3
Query:  414 KKLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAE-HFLGSRMLEVKIATPKEEMRAP 665
            +KL + G+ ++   + LR +  ++G L DCVVM++ +T RSRGFG+VT+A+ E+   A++A  H +  R++E K A  +E+ + P
Sbjct:   14 RKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRP 98          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: RA1L3_HUMAN (Putative heterogeneous nuclear ribonucleoprotein A1-like protein 3 OS=Homo sapiens GN=HNRPA1L3 PE=5 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.570e-11
Identity = 32/85 (37.65%), Postives = 56/85 (65.88%), Query Frame = 3
Query:  414 KKLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAE-HFLGSRMLEVKIATPKEEMRAP 665
            +KL + G+ ++   + LR +  ++G L DCVVM++ +T RSRGFG+VT+A+ E+   A++A  H +  R++E K A  +E+ + P
Sbjct:   14 RKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRP 98          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: ROA2_RAT (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus GN=Hnrnpa2b1 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.663e-11
Identity = 34/90 (37.78%), Postives = 56/90 (62.22%), Query Frame = 3
Query:  414 KKLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAE-HFLGSRMLEVKIATPKEEMRAPPRKVS 680
            +KL + G+ ++   + LR Y  ++G L DCVVM++ ++ RSRGFG+VTF+S  +   A++A  H +  R++E K A  +EE   P   V+
Sbjct:   21 RKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVT 110          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: ROA2_PONAB (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii GN=HNRNPA2B1 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.663e-11
Identity = 34/90 (37.78%), Postives = 56/90 (62.22%), Query Frame = 3
Query:  414 KKLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAE-HFLGSRMLEVKIATPKEEMRAPPRKVS 680
            +KL + G+ ++   + LR Y  ++G L DCVVM++ ++ RSRGFG+VTF+S  +   A++A  H +  R++E K A  +EE   P   V+
Sbjct:   21 RKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVT 110          
The following BLAST results are available for this feature:
BLAST of FC920417 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
RO32_XENLA2.734e-1138.82Heterogeneous nuclear ribonucleoprotein A3 homolog... [more]
RO31_XENLA2.734e-1138.82Heterogeneous nuclear ribonucleoprotein A3 homolog... [more]
ROA1_RAT3.570e-1137.65Heterogeneous nuclear ribonucleoprotein A1 OS=Ratt... [more]
ROA1_PANTR3.570e-1137.65Heterogeneous nuclear ribonucleoprotein A1 OS=Pan ... [more]
ROA1_MOUSE3.570e-1137.65Heterogeneous nuclear ribonucleoprotein A1 OS=Mus ... [more]
ROA1_HUMAN3.570e-1137.65Heterogeneous nuclear ribonucleoprotein A1 OS=Homo... [more]
ROA1_BOVIN3.570e-1137.65Heterogeneous nuclear ribonucleoprotein A1 OS=Bos ... [more]
RA1L3_HUMAN3.570e-1137.65Putative heterogeneous nuclear ribonucleoprotein A... [more]
ROA2_RAT4.663e-1137.78Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
ROA2_PONAB4.663e-1137.78Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008B04EF RVDevelop1 Citrus clementina cDNA clone C32008B04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920417 ID=FC920417|Name=FC920417|organism=Citrus clementina|type=EST|length=680bp
GATTGCTAGATAGAGGTAGGAAGAGGATTTTAGAGAGAGAGAGAGAGAGA
GAGAGAGAGGTCGATGCATTAGGGTTTTGAAAATCGGACCACAGATTCGA
TAAAGGTCAGTGAGCGCGCAATCTCCATTCAATTGATTGATTTTAATTTT
AATTTTAGAGGACAATTAAAAAAAAAATGGTGAGTTTGATGATTTGGCAT
TTGATGAATTGTGTGTGTGAGAAAGAGGTGTACTTTACATGTGCAGGAGG
AGGAATCGAGTGTGTTACTGGGAAGAAGAGAGATAGAGAGAAAATTGTAG
TGATTTGAGTGCTCGAGAACTGAGTTGTTTGAGCGTTAGGGGTTTTCCCC
TTTTCCTCATCTCTCCCTCTGTAGCCGCTTCTTTCATTTTTCCAGCTTTC
AATTCTCATGGAGAAAAAGCTTGTGGTTCTGGGTATTCCATGGGATGTCG
ATACAGATGGTTTAAGAGAGTACATGAGCAAATTTGGGGATTTGGAGGAC
TGCGTTGTCATGAAGGAGCGGTCCACAGGGCGATCGCGTGGATTTGGCTA
TGTTACATTTGCATCTGCTGAAGATGCTAAGACAGCTTTGTCAGCTGAGC
ACTTTCTTGGCAGCAGAATGCTAGAAGTTAAAATAGCTACCCCTAAGGAG
GAGATGAGAGCACCCCCAAGGAAAGTGTCC
back to top