FC920418

Overview
NameFC920418
Unique NameFC920418
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length673
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15452 contig Ccv1_Contig15452:3..675. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920418 vs. ExPASy Swiss-Prot
Match: CAT1_PENJA (Catalase OS=Penicillium janthinellum PE=1 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 7.515e-30
Identity = 78/170 (45.88%), Postives = 99/170 (58.24%), Query Frame = 2
Query:  179 SLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDV--IHAFKPNPKSHI----QEYWRILDFCSHLPESLSTFSWFFDDVG 670
            +L   SRG  LL+D    E +  F RER+PER VHARG  A G F    D S+LT A    A G  TP + RFSTV   RGS +T RD  GFA +FY  EGN+D++GN+IPVFFI D I  P +  +HA KPNP+ H+    Q+  RI D  +   +SL+  S    + G
Sbjct:   30 TLGAASRGATLLQDLLFTEIIFAFDRERVPERAVHARGTGAHGTFLSYEDWSNLTAASFLSAEGKFTPEMTRFSTVSGARGSADTARDVHGFATRFYVDEGNFDIVGNNIPVFFIWDVIIEPTLMALHAQKPNPRFHLPRGQQDPNRISDNLTARGDSLAQGSQISSERG 199          
The following BLAST results are available for this feature:
BLAST of FC920418 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 141
Match NameE-valueIdentityDescription
CAT1_PENJA7.515e-3045.88Catalase OS=Penicillium janthinellum PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008B05EF RVDevelop1 Citrus clementina cDNA clone C32008B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920418 ID=FC920418|Name=FC920418|organism=Citrus clementina|type=EST|length=673bp
ACACTCTTCTTGAGTCTCGACTCAACTCCACTTCTCCTTTCTTACGATAA
TAATAACAGTAGCAAAATCTTCAGCAAGAAATATCGCCATGGATCCCTAC
AAATTGCTTCCGTCAACTACTCACAATGCCCCCTTTATGACTACAAATGC
CGGCGCTCCTGTCTGGAACGACAATCACTCCTTGACTGTTGGAAGTAGAG
GTCCTGTCCTTCTTGAGGATTATCATCTGGTGGAGAAACTAGCTCATTTT
GCCAGGGAGAGGATTCCAGAACGCGTCGTCCATGCTAGGGGAGCCAGTGC
TAAGGGTTTCTTTGAGTGCACCCATGATATTTCTCACCTTACTTGTGCTG
ATCTTTTTCGAGCTCCAGGGGTTCAGACACCTGTCATTGTTCGCTTCTCC
ACTGTTATCCATGAGCGGGGCAGCCCTGAGACACTCAGGGATCCTCGAGG
ATTTGCAGTCAAGTTTTACACCAGAGAGGGTAATTGGGATCTTCTGGGTA
ACAGTATCCCTGTTTTTTTCATCCGTGATGCAATCAAATTCCCAGATGTG
ATCCATGCTTTTAAACCTAATCCAAAGTCTCACATCCAAGAGTACTGGAG
GATCCTCGACTTCTGCTCCCACCTTCCTGAAAGCTTGTCCACATTTTCCT
GGTTCTTTGATGATGTGGGTATT
back to top