FC920474

Overview
NameFC920474
Unique NameFC920474
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length678
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..683. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHSY_CATRO (Chalcone synthase OS=Catharanthus roseus GN=CHS PE=2 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 1.954e-102
Identity = 181/208 (87.02%), Postives = 197/208 (94.71%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            M  V+EIRNAQRA GPATVLAIGT+TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMC+KSMIKKRYM+LTEEIL+ENPN+CAYMAPSLDARQ+IVVVEVPKLGKEAA KAIKEWGQ KSKITHL+FCTTSGVDMPGADYQLTKL+GLR SVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+++HLDS
Sbjct:    1 MVNVEEIRNAQRAQGPATVLAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKRYMHLTEEILQENPNICAYMAPSLDARQNIVVVEVPKLGKEAAQKAIKEWGQSKSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSESHLDS 208          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS8_IPOBA (Chalcone synthase DIV OS=Ipomoea batatas GN=CHS-DIV PE=2 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 1.954e-102
Identity = 177/208 (85.10%), Postives = 193/208 (92.79%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            M TV+E+R AQRA+GPAT+LAIGT TPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSG+DMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++THLDS
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGIDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDS 208          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS5_TRISU (Chalcone synthase 5 OS=Trifolium subterraneum GN=CHS5 PE=2 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 1.954e-102
Identity = 179/208 (86.06%), Postives = 194/208 (93.27%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            M +V EIR AQRA+GPAT+LAIGTA PA+ V QA YPD+YF+IT SEH  ELKEKF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:    1 MVSVAEIRQAQRAEGPATILAIGTANPANKVEQATYPDFYFKITNSEHKVELKEKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS2_TRISU (Chalcone synthase 2 OS=Trifolium subterraneum GN=CHS2 PE=3 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 1.954e-102
Identity = 179/208 (86.06%), Postives = 194/208 (93.27%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            M +V EIR AQRA+GPAT+LAIGTA PA+ V QA YPD+YF+IT SEH  ELKEKF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANRVEQATYPDFYFKITNSEHKVELKEKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS1_IPOBA (Chalcone synthase LF1 OS=Ipomoea batatas GN=CHS-LF1 PE=2 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 1.954e-102
Identity = 177/208 (85.10%), Postives = 193/208 (92.79%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            M TV+E+R AQRA+GPAT+LAIGT TPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSG+DMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++THLDS
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGIDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDS 208          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHSY_PINSY (Chalcone synthase OS=Pinus sylvestris GN=CHS PE=3 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 2.552e-102
Identity = 178/208 (85.58%), Postives = 195/208 (93.75%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            M  ++  R AQRADGPAT+LAIGTATP ++V+Q+ YPDYYF+IT SEHMTELKEKF+RMCDKS IKKRYMYLTEEILKENP +C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITH+IFCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:    6 MKDLEAFRKAQRADGPATILAIGTATPPNAVDQSSYPDYYFKITNSEHMTELKEKFRRMCDKSAIKKRYMYLTEEILKENPKVCEYMAPSLDARQDMVVVEVPRLGKEAAAKAIKEWGQPKSKITHVIFCTTSGVDMPGADYQLTKLLGLRPSVKRVMMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDS 213          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS5_PEA (Chalcone synthase 5 OS=Pisum sativum GN=CHS5 PE=3 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 2.552e-102
Identity = 178/208 (85.58%), Postives = 195/208 (93.75%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YFRIT SEH TELK+KF+RMCDKSMI +RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFRITNSEHKTELKQKFQRMCDKSMINRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS3_PEA (Chalcone synthase 3 OS=Pisum sativum GN=CHS3 PE=3 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 2.552e-102
Identity = 178/208 (85.58%), Postives = 195/208 (93.75%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YFRIT SEH TELK+KF+RMCDKSMI +RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFRITNSEHKTELKQKFQRMCDKSMINRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS2_MAIZE (Chalcone synthase C2 OS=Zea mays GN=C2 PE=3 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 2.552e-102
Identity = 178/206 (86.41%), Postives = 195/206 (94.66%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            TV+E+R AQRA GPATVLAIGTATPA+ V QADYPDYYFRITKSEH+T+LKEKFKRMCDKSMI+KRYM+LTEE L ENP+MCAYMAPSLDARQD+VVVEVPKLGK AA KAIKEWGQPKS+ITHL+FCTTSGVDMPGADYQLTK +GLRPSV R MMYQQGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVYQADYPDYYFRITKSEHLTDLKEKFKRMCDKSMIRKRYMHLTEEFLAENPSMCAYMAPSLDARQDVVVVEVPKLGKAAAQKAIKEWGQPKSRITHLVFCTTSGVDMPGADYQLTKALGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDS 212          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHSY_ORYSJ (Chalcone synthase OS=Oryza sativa subsp. japonica GN=CHS PE=2 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 3.333e-102
Identity = 177/206 (85.92%), Postives = 195/206 (94.66%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            TV+E+R AQRA+GPATVLAIGTATPA+ V QADYPDYYFRITKSEHM ELKEKFKRMCDKS I+KRYM+LTEEIL+ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQP+S+ITHL+FCTTSGVDMPGADYQL K++GLRP+V R MMYQQGCFAGGTVLR+AKDLAENN+GARVL VCSEITAVTFRGP+++HLDS
Sbjct:    6 TVEEVRRAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITKSEHMVELKEKFKRMCDKSQIRKRYMHLTEEILQENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPRSRITHLVFCTTSGVDMPGADYQLAKMLGLRPNVNRLMMYQQGCFAGGTVLRVAKDLAENNRGARVLAVCSEITAVTFRGPSESHLDS 211          
The following BLAST results are available for this feature:
BLAST of FC920474 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSY_CATRO1.954e-10287.02Chalcone synthase OS=Catharanthus roseus GN=CHS PE... [more]
CHS8_IPOBA1.954e-10285.10Chalcone synthase DIV OS=Ipomoea batatas GN=CHS-DI... [more]
CHS5_TRISU1.954e-10286.06Chalcone synthase 5 OS=Trifolium subterraneum GN=C... [more]
CHS2_TRISU1.954e-10286.06Chalcone synthase 2 OS=Trifolium subterraneum GN=C... [more]
CHS1_IPOBA1.954e-10285.10Chalcone synthase LF1 OS=Ipomoea batatas GN=CHS-LF... [more]
CHSY_PINSY2.552e-10285.58Chalcone synthase OS=Pinus sylvestris GN=CHS PE=3 ... [more]
CHS5_PEA2.552e-10285.58Chalcone synthase 5 OS=Pisum sativum GN=CHS5 PE=3 ... [more]
CHS3_PEA2.552e-10285.58Chalcone synthase 3 OS=Pisum sativum GN=CHS3 PE=3 ... [more]
CHS2_MAIZE2.552e-10286.41Chalcone synthase C2 OS=Zea mays GN=C2 PE=3 SV=1[more]
CHSY_ORYSJ3.333e-10285.92Chalcone synthase OS=Oryza sativa subsp. japonica ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008H02EF RVDevelop1 Citrus clementina cDNA clone C32008H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920474 ID=FC920474|Name=FC920474|organism=Citrus clementina|type=EST|length=678bp
AGAACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAAGGG
CGCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCG
GCCCTGCCGATACTCATCTTGATTCTCT
back to top