FC920485

Overview
NameFC920485
Unique NameFC920485
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length705
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9492 contig Ccv1_Contig9492:17..721. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER15_IPOBA (Peroxidase 15 OS=Ipomoea batatas GN=pod PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.805e-27
Identity = 69/184 (37.50%), Postives = 97/184 (52.72%), Query Frame = 3
Query:  138 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTL-SEKE-MDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY 683
            L   FY  TCP    I++  V+   +       S +R  FHDC V  CD SLLLD+   T+ SEK+ +  +   R F  ++NIK AVE  CPGVVSC DIL L+    V   GGP   +  GRRD R +        LP   ++++ + ++F  +G++   LVAL G+H+ GR  C     RL+
Sbjct:   25 LSSTFYSTTCPNVSAIVRTVVQQALQNDARIGGSLIRLHFHDCFVDGCDGSLLLDNNGTTIVSEKDALPNTNSTRGFDVVDNIKTAVENACPGVVSCVDILALASESSVSLAGGPSWNVLLGRRDRRTANQGGANTSLPSPFENLTNLTQKFTNVGLNVNDLVALSGAHTFGRAQCRTFSPRLF 208          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER2_MAIZE (Peroxidase 2 OS=Zea mays GN=PER2 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 4.970e-27
Identity = 70/196 (35.71%), Postives = 108/196 (55.10%), Query Frame = 3
Query:  138 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDST--RKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDG--VVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVH---RLYPEVDPAL 704
            L + +Y+ TCPQAE I+K  ++    ++     + +R +FHDC V+ CDAS+LLD T    T  +     +  +R F  I+ IK+A+E  CPGVVSCADI+  + RD    ++ G     + +GR DG  S A    ++L     ++S +   FA  G+    LV L G+H+VGR+HC   V     +  +++PAL
Sbjct:   35 LELGYYRYTCPQAEAIVKASMEKAIAQNPGNGAAVIRMLFHDCFVEGCDASVLLDPTPFSPTPEKLAAPNNPSLRGFELIDAIKDALEAACPGVVSCADIIAFAARDASCFLSQGKVSFDMPSGRLDGTFSNASESVKFLVPPTSNLSDLASSFAVKGMSLEDLVVLSGAHTVGRSHCSSFVSDRLDVPSDINPAL 230          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER5_ARATH (Peroxidase 5 OS=Arabidopsis thaliana GN=PER5 PE=2 SV=2)

HSP 1 Score: 120.553 bits (301), Expect = 8.477e-27
Identity = 67/180 (37.22%), Postives = 99/180 (55.00%), Query Frame = 3
Query:  150 FYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSF-GMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKS-RAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY 683
            FY  +C  A   I+  V+    R +  A S +R  FHDC V  CDAS+LL+ T    SE++   +F  +R F  I+  K  VE+ CPG+VSCADI+ ++ RD    +GGP   +K GRRD   + +A      LP   D++  +   F+  G++   LVAL G+H++G++ C     RLY
Sbjct:   30 FYDQSCRNALSKIRSSVRTAIARERRMAASLIRMHFHDCFVHGCDASILLEGTSTIESERDALPNFKSVRGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDASEYVGGPKWAVKVGRRDSTAAFKALANSGELPGFKDTLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLY 209          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER2_ORYSJ (Peroxidase 2 OS=Oryza sativa subsp. japonica GN=PRX112 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 8.477e-27
Identity = 68/186 (36.56%), Postives = 93/186 (50.00%), Query Frame = 3
Query:  138 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVD 695
            L   FY  +CP A   IK  V            S +R  FHDC VQ CDAS+LL    +         +  +R F  ++NIK  VE  C   VSCADIL ++ RD VVALGGP   +  GRRD   +        LP  + S++ ++  F+  G+D   +VAL G+H++G+  C     RLY E +
Sbjct:   25 LSATFYDTSCPNALSTIKSAVTAAVNSEPRMGASLVRLHFHDCFVQGCDASVLLSGQEQNAGPN----AGSLRGFNVVDNIKTQVEAICSQTVSCADILAVAARDSVVALGGPSWTVLLGRRDSTTANESQANTDLPAPSSSLAELIGNFSRKGLDVTDMVALSGAHTIGQAQCQNFRDRLYNETN 206          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER2_ORYSI (Peroxidase 2 OS=Oryza sativa subsp. indica GN=PRX112 PE=3 SV=2)

HSP 1 Score: 120.553 bits (301), Expect = 8.477e-27
Identity = 68/186 (36.56%), Postives = 93/186 (50.00%), Query Frame = 3
Query:  138 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVD 695
            L   FY  +CP A   IK  V            S +R  FHDC VQ CDAS+LL    +         +  +R F  ++NIK  VE  C   VSCADIL ++ RD VVALGGP   +  GRRD   +        LP  + S++ ++  F+  G+D   +VAL G+H++G+  C     RLY E +
Sbjct:   25 LSATFYDTSCPNALSTIKSAVTAAVNSEPRMGASLVRLHFHDCFVQGCDASVLLSGQEQNAGPN----AGSLRGFNVVDNIKTQVEAICSQTVSCADILAVAARDSVVALGGPSWTVLLGRRDSTTANESQANTDLPAPSSSLAELIGNFSRKGLDVTDMVALSGAHTIGQAQCQNFRDRLYNETN 206          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER70_MAIZE (Peroxidase 70 OS=Zea mays GN=PER70 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.107e-26
Identity = 69/183 (37.70%), Postives = 96/183 (52.46%), Query Frame = 3
Query:  150 FYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFG-MRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVD 695
            FY  +CP+A   IK  V     +      S LR  FHDC VQ CD S+LL+ T     E+  + + G +R F  ++NIK  VE  CPGVVSCADIL ++ RD VVALGGP   +  GRRD   +   +    LP  +  ++ +   FA   +    LVAL G+H++G   C      +Y + +
Sbjct:   31 FYSRSCPRALATIKAAVTAAVAQEARMGASLLRLHFHDCFVQGCDGSVLLNDTATFTGEQTANPNVGSIRGFGVVDNIKAQVEAVCPGVVSCADILAVAARDSVVALGGPSWRVLLGRRDSTTASLALANSDLPAPSLDLANLTAAFAKKRLSRTDLVALSGAHTIGLAQCKNFRAHIYNDTN 213          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER42_MAIZE (Peroxidase 42 OS=Zea mays GN=PER42 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.107e-26
Identity = 69/186 (37.10%), Postives = 96/186 (51.61%), Query Frame = 3
Query:  138 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVD 695
            L   FY  +CP A   I   V     +      S LR  FHDC +Q CDAS+LL+ T    ++   + +   R F  + +IK  VE  CPGVVSCADIL ++ RDGVVALGGP   +  GRRD   S        LP    S+  +L  ++   +DA  +VAL G+H++G+  C      +Y + +
Sbjct:   31 LSSTFYDTSCPSAMSTISSGVNSAVAQQARVGASLLRLHFHDCFIQGCDASILLNDTSGEQTQPP-NLTLNPRAFDVVNSIKAQVEAACPGVVSCADILAVAARDGVVALGGPSWTVLLGRRDSTGSFPSQTSD-LPPPTSSLQALLAAYSKKNLDATDMVALSGAHTIGQAQCSSFNGHIYNDTN 214          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PERE5_ARMRU (Peroxidase E5 OS=Armoracia rusticana GN=HRPE5 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.889e-26
Identity = 68/181 (37.57%), Postives = 103/181 (56.91%), Query Frame = 3
Query:  147 NFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGM-RNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPG-LVALLGSHSVGRTHCVKLVHRLY 683
            +FY  TCP   +IIK  +    +     A S LR  FHDC V+ CDAS+LLD+++   +EK+   +    R F  I+ +K A+ER CP  VSCADIL ++ +  V+  GGP   +  GRRD  ++  ++    LP    +++ + + FA +G++ P  LVAL G H+ GR  C+ +  RLY
Sbjct:    5 DFYSRTCPSVFNIIKNVIVDELQTDPRIAASILRLHFHDCFVRGCDASILLDTSKSFRTEKDAAPNVNSARGFNVIDRMKTALERACPRTVSCADILTIASQISVLLSGGPSWAVPLGRRDSVEAFFDLANTALPSPFFTLAQLKKAFADVGLNRPSDLVALSGGHTFGRARCLFVTARLY 185          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER34_ARATH (Peroxidase 34 OS=Arabidopsis thaliana GN=PER34 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.889e-26
Identity = 68/184 (36.96%), Postives = 98/184 (53.26%), Query Frame = 3
Query:  138 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKE-MDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPG-LVALLGSHSVGRTHCVKLVHRLY 683
            L   FY  +CP   +I++E +    +     A S LR  FHDC V  CDAS+LLD+T    +EK+    +   R F  I+ +K AVER CP  VSCAD+L ++ +  V   GGP   +  GRRD  ++  E+    LP    ++  +   F  +G+D P  LVAL G H+ G+  C  ++ RLY
Sbjct:   32 LTPTFYDRSCPNVTNIVRETIVNELRSDPRIAASILRLHFHDCFVNGCDASILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAVERACPRTVSCADMLTIAAQQSVTLAGGPSWRVPLGRRDSLQAFLELANANLPAPFFTLPQLKASFRNVGLDRPSDLVALSGGHTFGKNQCQFILDRLY 215          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER33_ARATH (Peroxidase 33 OS=Arabidopsis thaliana GN=PER33 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.889e-26
Identity = 67/187 (35.83%), Postives = 101/187 (54.01%), Query Frame = 3
Query:  129 DPGLVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKE-MDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPG-LVALLGSHSVGRTHCVKLVHRLY 683
            D  L   FY  +CP   +I+++ +    +     A S LR  FHDC V  CDAS+LLD+T    +EK+ +  +   R F  I+ +K AVER CP  VSCAD+L ++ +  V   GGP   +  GRRD  ++  ++    LP    ++  +   F  +G+D P  LVAL G+H+ G+  C  ++ RLY
Sbjct:   30 DAQLTPTFYDTSCPTVTNIVRDTIVNELRSDPRIAGSILRLHFHDCFVNGCDASILLDNTTSFRTEKDALGNANSARGFPVIDRMKAAVERACPRTVSCADMLTIAAQQSVTLAGGPSWKVPLGRRDSLQAFLDLANANLPAPFFTLPQLKANFKNVGLDRPSDLVALSGAHTFGKNQCRFIMDRLY 216          
The following BLAST results are available for this feature:
BLAST of FC920485 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 108
Match NameE-valueIdentityDescription
PER15_IPOBA3.805e-2737.50Peroxidase 15 OS=Ipomoea batatas GN=pod PE=1 SV=1[more]
PER2_MAIZE4.970e-2735.71Peroxidase 2 OS=Zea mays GN=PER2 PE=2 SV=1[more]
PER5_ARATH8.477e-2737.22Peroxidase 5 OS=Arabidopsis thaliana GN=PER5 PE=2 ... [more]
PER2_ORYSJ8.477e-2736.56Peroxidase 2 OS=Oryza sativa subsp. japonica GN=PR... [more]
PER2_ORYSI8.477e-2736.56Peroxidase 2 OS=Oryza sativa subsp. indica GN=PRX1... [more]
PER70_MAIZE1.107e-2637.70Peroxidase 70 OS=Zea mays GN=PER70 PE=1 SV=1[more]
PER42_MAIZE1.107e-2637.10Peroxidase 42 OS=Zea mays GN=PER42 PE=2 SV=1[more]
PERE5_ARMRU1.889e-2637.57Peroxidase E5 OS=Armoracia rusticana GN=HRPE5 PE=1... [more]
PER34_ARATH1.889e-2636.96Peroxidase 34 OS=Arabidopsis thaliana GN=PER34 PE=... [more]
PER33_ARATH1.889e-2635.83Peroxidase 33 OS=Arabidopsis thaliana GN=PER33 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32009A06EF RVDevelop1 Citrus clementina cDNA clone C32009A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920485 ID=FC920485|Name=FC920485|organism=Citrus clementina|type=EST|length=705bp
GAAGGTTGGTCACCTTTAGTGAGTGAAGAGTAGAAGAGACAATGGGTACG
AAAGCTGTCTTCTTGCTTTTAGCTTTGCTTTCCTTCTCAGCTGTGTCTCT
GAGGTCTGCTTTGGCAGAAAATGAAGAGGACCCAGGTCTTGTTATGAATT
TTTACAAGGATACATGCCCTCAGGCCGAGGACATTATCAAGGAACAAGTT
AAGCTTCTGTACAAGCGCCACAAGAACACTGCATTTTCTTGGCTTAGAAA
CATTTTCCATGACTGTGCTGTCCAGTCTTGTGATGCTTCACTGCTTCTGG
ACTCGACAAGAAAGACCTTGTCTGAGAAGGAAATGGACAGGAGCTTTGGT
ATGAGGAACTTCAGGTACATTGAGAACATCAAAGAAGCTGTTGAAAGAGA
GTGCCCTGGTGTTGTTTCCTGTGCTGATATTCTTGTCCTGTCCGGTAGAG
ATGGCGTTGTTGCGCTTGGAGGCCCTTACATTCCTCTCAAGACAGGAAGA
AGAGATGGTAGAAAAAGCAGAGCAGAGATACTTGAGCAGTATCTCCCAGA
TCACAATGACAGCATGTCTGTTGTTCTTGAGAGGTTTGCAGCCATTGGCA
TTGACGCCCCTGGACTTGTTGCACTGCTAGGATCTCACAGTGTTGGCAGA
ACTCATTGTGTGAAGCTGGTGCACCGTCTGTACCCAGAAGTTGACCCTGC
ACTGA
back to top