FC920489

Overview
NameFC920489
Unique NameFC920489
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length732
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11415 contig Ccv1_Contig11415:1..731. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: EI3F1_DROPE (Eukaryotic translation initiation factor 3 subunit F-1 OS=Drosophila persimilis GN=eIF3-S5-1 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.190e-16
Identity = 52/171 (30.41%), Postives = 92/171 (53.80%), Query Frame = 2
Query:  146 VIVHPLVLLSIVDNYNRVAKDTRKRVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDV 658
            V VHP+VL  +VD + R   ++  RV+G LLGS  KG V+V+N + VP +E D        + +Y   MY + +++N+ E VVGW++TG  +  +   IH+ +     NPV + +D   +   +  ++Y  ++        K+  +F  +P E+ ++E E  G++ L + V
Sbjct:    8 VRVHPVVLFQVVDAFERRNAESH-RVIGTLLGSVEKGVVEVTNCFCVPHKEHDDQVEA---ELSYALDMYDLNRKVNSNEAVVGWWATGNDVTNHSSVIHEYYARECNNPVHLTVDTSLQGGRMGLRSYVCIQLGVPGG--KTGCMFTPIPVELTSYEPETFGLKLLQKTV 172          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: EIF3F_BOMMO (Eukaryotic translation initiation factor 3 subunit F OS=Bombyx mori GN=eIF3-S5 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.633e-15
Identity = 53/165 (32.12%), Postives = 84/165 (50.91%), Query Frame = 2
Query:  146 VIVHPLVLLSIVDNYNRVAKDTRKRVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVE 640
            V VHP+VL  IVD Y R   D+  RV+G L G+S KG V+V+N + VP +E          + NY   +Y + +R+N+ E +VGW++TG ++  +   IH+ +      PV V +D       +  +AY  V     N  Q    +F  V   +  +E E +G++
Sbjct:    7 VKVHPVVLFQIVDAYERRNADSH-RVIGTLWGTSDKGVVEVTNCFCVPHKEHADQVEA---ELNYAMDVYELNRRVNSSESIVGWWATGNEVTNHSSVIHEYYSRECREPVHVTLDTSLAGGRMGLRAYVCVPLGVPNGKQGC--MFTPVDVTLTCYEPEIVGLQ 165          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: EIF3F_USTMA (Eukaryotic translation initiation factor 3 subunit F OS=Ustilago maydis GN=UM00175 PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.761e-14
Identity = 56/168 (33.33%), Postives = 89/168 (52.98%), Query Frame = 2
Query:  128 SRPIEKVIVHPLVLLSIVDNYNRVAKDTRKRVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLF------HNYVPNPVLVIID-VQPKELGIPTKAYYDVEEVKENATQKSQK-VFVHVPSEI 607
            SR +  V VHP+ L SI+D+Y R   D + RV+G LLG+  +  +++ N +AVP  ED ++  +  +D  YH SMY + +++   E +VGWY+T P+L      I   +      H  V   +   ID  +P  LGI  K+Y         AT K++  VF+ +P+ +
Sbjct:   26 SRSVTGVHVHPVALFSILDHYLR-RNDGQHRVIGTLLGTRTESEIEIKNCFAVPHLEDAEEGQVQ-VDMEYHRSMYELCQKVRPDEVIVGWYATSPELNTYSALIQDFYSRETAPHQAVHLTMDTTIDGSKPSGLGI--KSYI---SSPLGATPKAENCVFLPLPTNL 186          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: CSN6_DICDI (COP9 signalosome complex subunit 6 OS=Dictyostelium discoideum GN=csn6 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.320e-13
Identity = 55/196 (28.06%), Postives = 96/196 (48.98%), Query Frame = 2
Query:   80 TQRDSNMDVIKTQQISSRPIEKVIVHPLVLLSIVDNYNRVAKDTRK----RVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDV-QPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLR 652
            T  D+N  V++    SS    +V +HPLVL++I D++ R    +      RV+GV+LG      V++ NS+ + +   DK      LD  Y    Y   +++     ++GWYSTG ++ ++D+ +H+    +  +P+ +++D   PK   +P   Y   E        +   +FV  P +I   E E IGV H+ +
Sbjct:    8 TTTDANKLVLEKSANSSGL--EVDLHPLVLINISDHFTRTKVQSNYQDNCRVIGVILGVQNGRNVEICNSFEMVYATVDKQ---LVLDIEYLRKKY---EQLFPLYDLLGWYSTGSQVSKDDILLHKQISEHNESPLYLMLDTDSPKSKDLPVIIY---ESELHIVNDEPTTIFVKTPYKIQTGEAERIGVNHIAK 192          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: EIF3F_MALGO (Eukaryotic translation initiation factor 3 subunit F OS=Malassezia globosa (strain ATCC 96807 / CBS 7966) GN=MGL_1945 PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.663e-13
Identity = 56/184 (30.43%), Postives = 88/184 (47.83%), Query Frame = 2
Query:  128 SRPIEKVIVHPLVLLSIVDNYNRVAKD-TRKRVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDI----------HQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHL 646
            SR I  V VHP+ L SI+D+Y R  +D ++ RV+G LLG+  +  V+V N++AVP  E  +DP    LD  +H  M  +  R+   E V+GWYST  +L  N   I          HQ  H      + +  +V  +  G+  + Y  V  +     +     F+ +P+ +     E+  + HL
Sbjct:   27 SRSITAVKVHPVALFSILDHYLR--RDVSQPRVIGTLLGTRSESEVEVRNAFAVPHGES-QDPWQIHLDAEHHRRMLDLHLRVRPDEVVLGWYSTNTELNSNSALIQDHYSRETAPHQAIH------LTLNTNVADEANGLGVQCY--VSALLGAMAKPEDCAFLSLPTHLLMSTPEQTALRHL 199          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: CSN6B_ARATH (COP9 signalosome complex subunit 6b OS=Arabidopsis thaliana GN=CSN6B PE=1 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 5.663e-13
Identity = 51/189 (26.98%), Postives = 86/189 (45.50%), Query Frame = 2
Query:  152 VHPLVLLSIVDNYNRVAKDTRK----------------------RVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIID--VQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHL 646
            +HPLV+L+I D++ RV                            RV G ++G     TV++ NS+ + F     DP +  LD ++ E    ++K++    +V+GWYSTG    E+D+ IH+   +   +PV V+++  +   +  +P   Y     V +      Q +FVH    I   E E I V+H+
Sbjct:   13 LHPLVMLNISDHFTRVKTQLNPPAASCATGNGSNNADAMLLQNPRVYGCVIGLQRGRTVEIFNSFELIF-----DPALDTLDRSFLEKKQELYKKVFPDFYVLGWYSTGSDATESDMHIHKALMDINESPVYVLLNPAINHAQKDLPVTIYESEFHVIDGI---PQSIFVHTSYTIETVEAERISVDHV 193          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: EIF3F_DICDI (Eukaryotic translation initiation factor 3 subunit F OS=Dictyostelium discoideum GN=eif3f PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.648e-12
Identity = 50/189 (26.46%), Postives = 93/189 (49.21%), Query Frame = 2
Query:  146 VIVHPLVLLSIVDNYNR--VAKDTRKRVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPN--PVLVIID--VQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLANEV 694
            V VHP+V+ +I+D+Y R  V +D   RV+G LLG +  G +++ N + V   E ++      ++  Y   M  +  + + +E ++GWY+TG  + EN + I+  + + + N  P+ + +D  +    +GI     Y    +  N        F  +P EI   E E  G+E + +   D   ++L +E+
Sbjct:   15 VKVHPVVIFNILDHYIRRNVGQD---RVIGTLLGFNNDGVLEIRNCFPVVHSETEQIA----VEMEYQRKMLDLHLKSSPREPIIGWYATGNDINENSVHINNFYRDEMGNSTPIHLTVDTGLTNDTMGIHA---YMAHNLSLNPESSLGSYFSQLPLEILTFEAENAGLESIAQTKYDQQSTSLLSEL 193          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: CSN6A_ARATH (COP9 signalosome complex subunit 6a OS=Arabidopsis thaliana GN=CSN6A PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 6.262e-12
Identity = 48/189 (25.40%), Postives = 84/189 (44.44%), Query Frame = 2
Query:  152 VHPLVLLSIVDNYNRVAKDTRK----------------------RVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIID--VQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHL 646
            +HPLV+++I D+Y RV                            RV G ++G     TV++ NS+ + +     DP    LD ++ E    ++K++    +++GWYSTG    E+D+ IH+   +   +PV V+++  +   +  +P   Y     V +      Q +F H    I   E E I V+H+
Sbjct:   13 LHPLVIVNISDHYTRVKTQLNPPASICASGHGSNNGEAMFQQNPRVYGCVIGVQRGRTVEIFNSFELLY-----DPSTQTLDRSFLEKKQELYKKVFPDFYILGWYSTGSDAEESDMHIHKALMDINESPVYVLLNPAINHTQKDLPVTIYESELHVIDGI---PQLIFAHTSYTIETVEAERISVDHV 193          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: CSN6_XENLA (COP9 signalosome complex subunit 6 OS=Xenopus laevis GN=cops6 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 8.178e-12
Identity = 42/171 (24.56%), Postives = 85/171 (49.71%), Query Frame = 2
Query:  146 VIVHPLVLLSIVDNYNRVAKDTRK--RVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLR 652
            V +HPLV+L+I D++ R+     +  +V+G L+G      ++V NS+ +  + +D+   I   +  Y+ +    FK++      +GWY+TG     +D+ +H+     + +P+ + ++   K   +P   Y   E V +    ++  +   +   +A  E E IGV+H+ R
Sbjct:   32 VALHPLVILNISDHWIRMRSQEGRPMQVIGALIGKQEGRNIEVMNSFELLSQINDEKITI---NKEYYYTKEEQFKQVFKDMEFLGWYTTGGTPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSVY---ESVIDIVNGEATMLLAELSYTLATEEAERIGVDHVAR 196          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: CSN6_PONAB (COP9 signalosome complex subunit 6 OS=Pongo abelii GN=COPS6 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.068e-11
Identity = 41/171 (23.98%), Postives = 85/171 (49.71%), Query Frame = 2
Query:  146 VIVHPLVLLSIVDNYNRVAKDTRK--RVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLR 652
            V +HPLV+L+I D++ R+     +  +V+G L+G      ++V NS+ +     ++      +D  Y+ +    FK++  +   +GWY+TG     +D+ +H+     + +P+ + ++   K   +P   +   E V +    ++  +F  +   +A  E E IGV+H+ R
Sbjct:   42 VALHPLVILNISDHWIRMRSQEGRPVQVIGALIGKQEGRNIEVMNSFELLSHTVEEKI---IIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSVF---ESVIDIINGEATMLFAELTYTLATEEAERIGVDHVAR 206          
The following BLAST results are available for this feature:
BLAST of FC920489 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 46
Match NameE-valueIdentityDescription
EI3F1_DROPE4.190e-1630.41Eukaryotic translation initiation factor 3 subunit... [more]
EIF3F_BOMMO4.633e-1532.12Eukaryotic translation initiation factor 3 subunit... [more]
EIF3F_USTMA1.761e-1433.33Eukaryotic translation initiation factor 3 subunit... [more]
CSN6_DICDI3.320e-1328.06COP9 signalosome complex subunit 6 OS=Dictyosteliu... [more]
EIF3F_MALGO5.663e-1330.43Eukaryotic translation initiation factor 3 subunit... [more]
CSN6B_ARATH5.663e-1326.98COP9 signalosome complex subunit 6b OS=Arabidopsis... [more]
EIF3F_DICDI1.648e-1226.46Eukaryotic translation initiation factor 3 subunit... [more]
CSN6A_ARATH6.262e-1225.40COP9 signalosome complex subunit 6a OS=Arabidopsis... [more]
CSN6_XENLA8.178e-1224.56COP9 signalosome complex subunit 6 OS=Xenopus laev... [more]
CSN6_PONAB1.068e-1123.98COP9 signalosome complex subunit 6 OS=Pongo abelii... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32009A11EF RVDevelop1 Citrus clementina cDNA clone C32009A11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920489 ID=FC920489|Name=FC920489|organism=Citrus clementina|type=EST|length=732bp
GGTCAACAAAGCCATAAAAAGAAAAATCAACTGAGAAGGGGTTTTAAGTA
CAGACTACAGAGAGCAAAAGTGACAACAAACACAGAGAGATTCGAATATG
GACGTGATAAAGACGCAGCAAATTTCATCGAGACCCATAGAGAAGGTCAT
AGTTCACCCGCTCGTCTTACTAAGCATCGTCGACAATTACAACCGCGTCG
CCAAGGACACGCGCAAGCGCGTCGTCGGCGTCCTCCTCGGTAGCTCCTTC
AAAGGCACCGTCGATGTCTCCAACAGCTACGCAGTGCCTTTTGAGGAAGA
TGACAAAGACCCAGGAATATGGTTTCTCGACCACAACTACCATGAATCAA
TGTATTCAATGTTCAAAAGAATCAATGCCAAGGAGCATGTCGTAGGTTGG
TACAGTACAGGACCCAAGCTACGAGAGAATGATCTTGACATTCACCAATT
ATTTCACAACTATGTCCCAAATCCTGTATTGGTCATTATTGATGTCCAAC
CAAAGGAGCTTGGAATACCCACCAAGGCTTACTATGATGTTGAGGAGGTT
AAAGAGAATGCTACTCAGAAAAGCCAAAAGGTCTTTGTACACGTGCCATC
AGAAATTGCCGCTCATGAAGTCGAAGAAATCGGAGTGGAGCACTTGCTAA
GGGACGTGAAAGACACCACCATCAGTACACTTGCAAATGAGGTCACTGGA
AAACTACAGCCCTAAGGGTCTGGATGCTCGTT
back to top