FC920494

Overview
NameFC920494
Unique NameFC920494
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length654
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14378 contig Ccv1_Contig14378:3..656. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP1_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 8.513e-31
Identity = 67/115 (58.26%), Postives = 81/115 (70.43%), Query Frame = 1
Query:   97 ALKLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVP--CCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 435
            +LKL   +VLCM+V  PL+  A+T GQVT SLAPCI YLR  G   VP  CC G++SLN+AA+TTP RQ AC C+K AA  I  +N   A GLP  CGV+IPYKIS STDC+ V+
Sbjct:    2 SLKLACVVVLCMVVGAPLAQGAVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLNSAAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSVK 116          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP_SPIOL (Non-specific lipid-transfer protein OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 132.88 bits (333), Expect = 1.452e-30
Identity = 63/113 (55.75%), Postives = 80/113 (70.80%), Query Frame = 1
Query:   94 AALKLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            A +KL  A++LC++V  P +   ITCG V+  LAPCI YL+ GGP+   CC G+++LNAAA TTPDR+TACNCLK AA +I  +N   A GLP  CGV IPY IS ST+C+ V
Sbjct:    5 AVIKLACAVLLCIVVAAPYAEAGITCGMVSSKLAPCIGYLK-GGPLGGGCCGGIKALNAAAATTPDRKTACNCLKSAANAIKGINYGKAAGLPGMCGVHIPYAISPSTNCNAV 116          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP3_LENCU (Non-specific lipid-transfer protein 3 OS=Lens culinaris PE=3 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.896e-30
Identity = 62/107 (57.94%), Postives = 76/107 (71.03%), Query Frame = 1
Query:  115 ALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 435
            ALV+CM+V  P++  A++CG VTG LAPCI YL  G      CC GV+ L AAA TT DRQ ACNCLK AAG+I NLNP NA  LP  C V+IPYKIS +T+C+ ++
Sbjct:   11 ALVMCMVVIAPMAEAAVSCGTVTGDLAPCIPYLTGGAGPTDSCCAGVKKLLAAAPTTADRQAACNCLKTAAGNINNLNPGNAAALPGKCNVNIPYKISTTTNCNTIK 117          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTPA_BRAOT (Non-specific lipid-transfer protein A OS=Brassica oleracea var. italica GN=WAX9A PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 5.518e-30
Identity = 59/114 (51.75%), Postives = 83/114 (72.81%), Query Frame = 1
Query:  100 LKLVSALVLCMLVTGPLSA-QAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSI-PNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 435
            +KL   ++ CM+V GP++A +A+TCG V  ++APCI Y+  GG +P  CC GV  LN+ ARTTPDRQ AC CL+ AA ++ PNLN   A G+P+ACGVS+P+ IS +T+C+ V+
Sbjct:    5 MKLACLVLACMIVAGPITANRALTCGTVNSNVAPCIGYITQGGTLPGACCTGVSKLNSMARTTPDRQQACRCLETAARALGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNVK 118          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTPD_BRAOT (Non-specific lipid-transfer protein D OS=Brassica oleracea var. italica GN=WAX9D PE=3 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.738e-29
Identity = 60/114 (52.63%), Postives = 81/114 (71.05%), Query Frame = 1
Query:  100 LKLVSALVLCMLVTGPLSAQA-ITCGQVTGSLAPCIVYLRSGGP-IPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 435
            +KL   +  CM+V GP+++ A ++CG V+G +APCI YL    P +P  CC+GV SLN  ARTTPDRQ AC CL  AA ++P +N   A GLP+ACGV+IPYKIS +T+C+ V+
Sbjct:    5 MKLACLIFACMIVAGPITSNAALSCGTVSGYVAPCIGYLAQNAPAVPTACCSGVTSLNNMARTTPDRQQACRCLVGAANALPTINVARAAGLPKACGVNIPYKISKTTNCNSVK 118          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP1_ARATH (Non-specific lipid-transfer protein 1 OS=Arabidopsis thaliana GN=LTP1 PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.738e-29
Identity = 60/114 (52.63%), Postives = 83/114 (72.81%), Query Frame = 1
Query:  100 LKLVSALVLCMLVTGPLSAQA-ITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSI-PNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 435
            +KL   L+ CM+V GP+++ A ++CG V  +LA CI Y+  GG IP  CC+GV++LN+ A+TTPDRQ ACNC++ AA ++   LN   A G+P+ACGV+IPYKIS ST+C  VR
Sbjct:    5 MKLACLLLACMIVAGPITSNAALSCGSVNSNLAACIGYVLQGGVIPPACCSGVKNLNSIAKTTPDRQQACNCIQGAARALGSGLNAGRAAGIPKACGVNIPYKISTSTNCKTVR 118          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP_DAUCA (Non-specific lipid-transfer protein OS=Daucus carota GN=EP2 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.577e-29
Identity = 65/111 (58.56%), Postives = 81/111 (72.97%), Query Frame = 1
Query:  109 VSALVLCM-LVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVP--CCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            V+ +V+ M L T P +   +TCGQVTG+LAPC+ YLRS   +PVP  CCN VR LN AARTT D++TAC CLKQ A ++  LN N A GLP  CGV+IPYKIS +TDC++V
Sbjct:    9 VAMMVMYMVLATTPNAEAVLTCGQVTGALAPCLGYLRSQVNVPVPLTCCNVVRGLNNAARTTLDKRTACGCLKQTANAVTGLNLNAAAGLPARCGVNIPYKISPTTDCNRV 119          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP1_ORYSJ (Non-specific lipid-transfer protein 1 OS=Oryza sativa subsp. japonica GN=LTP PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.101e-29
Identity = 64/115 (55.65%), Postives = 76/115 (66.09%), Query Frame = 1
Query:   91 MAALKLVS-ALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            MA  +LV  ALV  +L+  P +A AITCGQV  ++ PC+ Y R G      CC+GVRSL AAA TT DR+TACNCLK AA  I  LN  NA  +P  CGVS+PY IS S DCS+V
Sbjct:    1 MARAQLVLVALVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRV 115          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP1_ORYSI (Non-specific lipid-transfer protein 1 OS=Oryza sativa subsp. indica GN=LTP PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.101e-29
Identity = 64/115 (55.65%), Postives = 76/115 (66.09%), Query Frame = 1
Query:   91 MAALKLVS-ALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            MA  +LV  ALV  +L+  P +A AITCGQV  ++ PC+ Y R G      CC+GVRSL AAA TT DR+TACNCLK AA  I  LN  NA  +P  CGVS+PY IS S DCS+V
Sbjct:    1 MARAQLVLVALVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRV 115          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP3_ARATH (Non-specific lipid-transfer protein 3 OS=Arabidopsis thaliana GN=LTP3 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 7.968e-29
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:   97 ALKLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 435
            AL+  + LVL + +   + A AI+CG V GSLAPC  YL  GG +P  CC GV++LN+ A+TTPDRQ AC C++  A SI  LNP+ A GLP  CGVSIPY IS+ST+C+ ++
Sbjct:    4 ALRFFTCLVLTVCIVASVDA-AISCGTVAGSLAPCATYLSKGGLVPPSCCAGVKTLNSMAKTTPDRQQACRCIQSTAKSISGLNPSLASGLPGKCGVSIPYPISMSTNCNNIK 115          
The following BLAST results are available for this feature:
BLAST of FC920494 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLTP1_GOSHI8.513e-3158.26Non-specific lipid-transfer protein OS=Gossypium h... [more]
NLTP_SPIOL1.452e-3055.75Non-specific lipid-transfer protein OS=Spinacia ol... [more]
NLTP3_LENCU1.896e-3057.94Non-specific lipid-transfer protein 3 OS=Lens culi... [more]
NLTPA_BRAOT5.518e-3051.75Non-specific lipid-transfer protein A OS=Brassica ... [more]
NLTPD_BRAOT2.738e-2952.63Non-specific lipid-transfer protein D OS=Brassica ... [more]
NLTP1_ARATH2.738e-2952.63Non-specific lipid-transfer protein 1 OS=Arabidops... [more]
NLTP_DAUCA3.577e-2958.56Non-specific lipid-transfer protein OS=Daucus caro... [more]
NLTP1_ORYSJ6.101e-2955.65Non-specific lipid-transfer protein 1 OS=Oryza sat... [more]
NLTP1_ORYSI6.101e-2955.65Non-specific lipid-transfer protein 1 OS=Oryza sat... [more]
NLTP3_ARATH7.968e-2953.10Non-specific lipid-transfer protein 3 OS=Arabidops... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32009B05EF RVDevelop1 Citrus clementina cDNA clone C32009B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920494 ID=FC920494|Name=FC920494|organism=Citrus clementina|type=EST|length=654bp
GACTCAACTCAAGCTTCTGAACACAGCTAGCCATAAACAAAGGCAAAAAA
AAAAAGAAAAAGAAAAAGAAAATCTCAGGAGAAATCTCAAATGGCTGCCC
TCAAGCTTGTTTCAGCTTTGGTTCTGTGCATGTTGGTGACTGGTCCCCTG
AGTGCTCAGGCCATAACATGTGGGCAGGTGACTGGCTCATTGGCACCATG
CATCGTTTACTTGAGATCGGGCGGCCCTATACCTGTGCCATGCTGCAACG
GCGTCAGGTCTCTCAACGCTGCCGCCAGAACCACACCTGACCGCCAAACT
GCATGCAACTGCTTGAAGCAAGCCGCCGGATCAATCCCTAACCTCAACCC
TAATAATGCTGTTGGTCTTCCACGAGCTTGTGGAGTCAGCATTCCTTACA
AGATCAGCATCTCCACTGACTGCTCTAAGGTCCGGTCAACAGGAATCTGG
GCTGTTGATTTTCATATTTAAGTTGACGGAGTAGAATAAATGTATAATAA
TAAGGACATTTTTGTGTCCGAATTATGAGTCTCTCTCTACACTTTGTACT
GCGAGTCTCGTTCCCGCCCTCGTTTCATGTTGTGTCTTATTGTCTTTGCT
TTTCATGTCATCGTCAGTTTGTGTCTATTCTGTTTATTAATGAAATCTTG
CCTT
back to top