FC920494

Overview
NameFC920494
Unique NameFC920494
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length654
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14378 contig Ccv1_Contig14378:3..656. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP4_ORYSJ (Non-specific lipid-transfer protein 4 OS=Oryza sativa subsp. japonica GN=Os12g0114500 PE=3 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 5.344e-25
Identity = 57/113 (50.44%), Postives = 76/113 (67.26%), Query Frame = 1
Query:  103 KLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVP---CCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            K V+A+++  L+    +A A+TCGQV   LAPCI+Y  + G +  P   CC+GVR+LN+AA TT DRQT C CLKQ   ++  L P+   G+P  CGV+IPY IS STDCS+V
Sbjct:    8 KYVAAVMVVALLLAAPAASAVTCGQVVSMLAPCIMY--ATGRVSAPTGGCCDGVRTLNSAAATTADRQTTCACLKQQTSAMGGLRPDLVAGIPSKCGVNIPYAISPSTDCSRV 118          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP5_VITSX (Non-specific lipid-transfer protein P5 OS=Vitis sp. PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.191e-24
Identity = 53/90 (58.89%), Postives = 65/90 (72.22%), Query Frame = 1
Query:  163 ITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            ++CG V   LAPCI YLRS GP+PV CCNGV++L  +A TT DR+TAC CL  A+ SI  +N   A GLP  CGV+IPYKIS ST+C +V
Sbjct:    1 LSCGDVATQLAPCINYLRSAGPLPVACCNGVKNLKNSAATTQDRRTACKCLINASKSISGVNFGLAAGLPGKCGVNIPYKISPSTNCDQV 90          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP5_ARATH (Non-specific lipid-transfer protein 5 OS=Arabidopsis thaliana GN=LTP5 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.031e-24
Identity = 59/114 (51.75%), Postives = 77/114 (67.54%), Query Frame = 1
Query:  100 LKLVSALVLCMLVTGPLSAQA-ITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSI-PNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 435
            LKL + +++CMLVT P++++A I+CG VTGSL  C  YL  GG IP  CC+GV+ LN+ ARTT DRQ AC C++ AA ++   LN   A  LP AC V I Y IS  T+C+ VR
Sbjct:    5 LKLSTLVIVCMLVTAPMASEAAISCGAVTGSLGQCYNYLTRGGFIPRGCCSGVQRLNSLARTTRDRQQACRCIQGAARALGSRLNAGRAARLPGACRVRISYPISARTNCNTVR 118          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP1_HORVU (Non-specific lipid-transfer protein 1 OS=Hordeum vulgare GN=LTP1 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 5.909e-24
Identity = 54/114 (47.37%), Postives = 74/114 (64.91%), Query Frame = 1
Query:   94 AALKLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPV-PCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            A + L++A ++ ML   P +A A+ CGQV   + PC+ Y++ GGP P   CCNGVR L+  A+++ DRQT CNCLK  A  I NLN NNA  +P  C V++PY IS   DCS++
Sbjct:    4 AQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQ-GGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI 116          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLT42_HORVU (Non-specific lipid-transfer protein 4.2 OS=Hordeum vulgare GN=LTP4.2 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 7.717e-24
Identity = 59/119 (49.58%), Postives = 79/119 (66.39%), Query Frame = 1
Query:   85 SQMAALKLVS-ALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLR-SGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 435
            ++ AA +LV  A+V  ML+    +  AI+CGQV+ +L+PCI Y R +G   PV CC+GV+ L  AA++T D+Q AC C+K AAG    LN   A G+P  CGVS+PY IS S DCSK+R
Sbjct:    2 ARAAATQLVLVAMVAAMLIVA--TDAAISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAAG---GLNAGKAAGIPSMCGVSVPYAISASVDCSKIR 115          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLT43_HORVU (Non-specific lipid-transfer protein 4.3 OS=Hordeum vulgare GN=LTP4.3 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.316e-23
Identity = 59/119 (49.58%), Postives = 79/119 (66.39%), Query Frame = 1
Query:   85 SQMAALKLVS-ALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLR-SGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 435
            ++ AA +LV  A+V  ML+    +  AI+CGQV+ +L+PCI Y R +G   PV CC+GV+ L  AA++T D+Q AC C+K AAG    LN   A G+P  CGVS+PY IS S DCSK+R
Sbjct:    2 ARAAATQLVLVAMVAAMLLVA--TDAAISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAAG---GLNAGKAAGIPSMCGVSVPYAISASVDCSKIR 115          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP6_GOSHI (Non-specific lipid-transfer protein 6 OS=Gossypium hirsutum GN=LTP6 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.719e-23
Identity = 56/115 (48.70%), Postives = 70/115 (60.87%), Query Frame = 1
Query:   97 ALKLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVP--CCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 435
            +LKL   +VLC+LV  PL+  AI+  QV  SL PC+ Y+R     P P   C G+RSL +AAR   DRQ AC C+K  A  I ++N   A GLP  C V IPYKIS S DC +V+
Sbjct:    6 SLKLACVVVLCLLVDAPLAQGAISYDQVKSSLLPCVGYVRGNNARPAPPNYCKGIRSLKSAARIRLDRQAACKCIKSLAADISDINYGVAAGLPGQCNVHIPYKISPSIDCKRVK 120          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLT41_HORVU (Non-specific lipid-transfer protein 4.1 OS=Hordeum vulgare GN=LTP4.1 PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.245e-23
Identity = 56/118 (47.46%), Postives = 76/118 (64.41%), Query Frame = 1
Query:   85 SQMAALKLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLR-SGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 435
            SQ+  + LV+A++L        +  AI+CGQV+ +L+PCI Y R +G   P  CC+GV+ L  AA++T D+Q AC C+K AAG    LN   A G+P  CGVS+PY IS S DCSK+R
Sbjct:    7 SQLVLVALVAAMLLVA------ADAAISCGQVSSALSPCISYARGNGAKPPAACCSGVKRLAGAAQSTADKQAACKCIKSAAG---GLNAGKAAGIPSMCGVSVPYAISASVDCSKIR 115          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTPC_ARATH (Non-specific lipid-transfer protein 12 OS=Arabidopsis thaliana GN=LTP12 PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 3.830e-23
Identity = 49/110 (44.55%), Postives = 66/110 (60.00%), Query Frame = 1
Query:  103 KLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            K+++ L++  +     +   I CG VT +LA C+ YL + GP+P  CC GV+SL   A+TTPDR+  C CLK A   I  LN +    LP  CGVSIPY IS ST+C  +
Sbjct:    6 KIITCLIVLTIYMASPTESTIQCGTVTSTLAQCLTYLTNSGPLPSQCCVGVKSLYQLAQTTPDRKQVCECLKLAGKEIKGLNTDLVAALPTTCGVSIPYPISFSTNCDSI 115          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP3_HORVU (Non-specific lipid-transfer protein 3 OS=Hordeum vulgare GN=LTP3 PE=3 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 5.002e-23
Identity = 57/118 (48.31%), Postives = 79/118 (66.95%), Query Frame = 1
Query:   85 SQMAALKLVS-ALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLR-SGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            ++ AA +LV  A+V  ML+    +  AI+CGQV+ +L+PCI Y R +G   PV CC+GV+ L  AA++T D+Q AC CLK  A SI  +N     G+P  CGVS+P+ IS+STDC+KV
Sbjct:    2 ARAAATQLVLVAMVAAMLLVA--TDAAISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACRCLKSLATSIKGINMGKVSGVPGKCGVSVPFPISMSTDCNKV 117          
The following BLAST results are available for this feature:
BLAST of FC920494 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLTP4_ORYSJ5.344e-2550.44Non-specific lipid-transfer protein 4 OS=Oryza sat... [more]
NLTP5_VITSX1.191e-2458.89Non-specific lipid-transfer protein P5 OS=Vitis sp... [more]
NLTP5_ARATH2.031e-2451.75Non-specific lipid-transfer protein 5 OS=Arabidops... [more]
NLTP1_HORVU5.909e-2447.37Non-specific lipid-transfer protein 1 OS=Hordeum v... [more]
NLT42_HORVU7.717e-2449.58Non-specific lipid-transfer protein 4.2 OS=Hordeum... [more]
NLT43_HORVU1.316e-2349.58Non-specific lipid-transfer protein 4.3 OS=Hordeum... [more]
NLTP6_GOSHI1.719e-2348.70Non-specific lipid-transfer protein 6 OS=Gossypium... [more]
NLT41_HORVU2.245e-2347.46Non-specific lipid-transfer protein 4.1 OS=Hordeum... [more]
NLTPC_ARATH3.830e-2344.55Non-specific lipid-transfer protein 12 OS=Arabidop... [more]
NLTP3_HORVU5.002e-2348.31Non-specific lipid-transfer protein 3 OS=Hordeum v... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32009B05EF RVDevelop1 Citrus clementina cDNA clone C32009B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920494 ID=FC920494|Name=FC920494|organism=Citrus clementina|type=EST|length=654bp
GACTCAACTCAAGCTTCTGAACACAGCTAGCCATAAACAAAGGCAAAAAA
AAAAAGAAAAAGAAAAAGAAAATCTCAGGAGAAATCTCAAATGGCTGCCC
TCAAGCTTGTTTCAGCTTTGGTTCTGTGCATGTTGGTGACTGGTCCCCTG
AGTGCTCAGGCCATAACATGTGGGCAGGTGACTGGCTCATTGGCACCATG
CATCGTTTACTTGAGATCGGGCGGCCCTATACCTGTGCCATGCTGCAACG
GCGTCAGGTCTCTCAACGCTGCCGCCAGAACCACACCTGACCGCCAAACT
GCATGCAACTGCTTGAAGCAAGCCGCCGGATCAATCCCTAACCTCAACCC
TAATAATGCTGTTGGTCTTCCACGAGCTTGTGGAGTCAGCATTCCTTACA
AGATCAGCATCTCCACTGACTGCTCTAAGGTCCGGTCAACAGGAATCTGG
GCTGTTGATTTTCATATTTAAGTTGACGGAGTAGAATAAATGTATAATAA
TAAGGACATTTTTGTGTCCGAATTATGAGTCTCTCTCTACACTTTGTACT
GCGAGTCTCGTTCCCGCCCTCGTTTCATGTTGTGTCTTATTGTCTTTGCT
TTTCATGTCATCGTCAGTTTGTGTCTATTCTGTTTATTAATGAAATCTTG
CCTT
back to top