FC920494

Overview
NameFC920494
Unique NameFC920494
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length654
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14378 contig Ccv1_Contig14378:3..656. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP3_VITSX (Non-specific lipid-transfer protein P3 OS=Vitis sp. PE=1 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 1.114e-22
Identity = 49/90 (54.44%), Postives = 62/90 (68.89%), Query Frame = 1
Query:  163 ITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            ++CG V   +A CI YLR  GP+P  CCNGV++L  +A TT DR+TAC CL  A+ +I  +N   A GLP  CGVSIPYKIS ST+C +V
Sbjct:    1 LSCGDVATQMASCINYLRGAGPLPAACCNGVKNLKNSATTTQDRRTACKCLISASKTISGVNFGLAAGLPAKCGVSIPYKISPSTNCDQV 90          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP1_WHEAT (Non-specific lipid-transfer protein (Fragment) OS=Triticum aestivum PE=1 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 2.483e-22
Identity = 53/114 (46.49%), Postives = 76/114 (66.67%), Query Frame = 1
Query:   94 AALKLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPV-PCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            A + L++  ++ ML   P +A AI CG V   + PC+ Y++ GGP P   CC+GV++L+  AR+  DRQ+ACNCLK  A  I NLN +NA  +P  CGV++PY IS++ DCS+V
Sbjct:    1 AQVMLMAVALVLMLAAVPRAAVAIDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV 113          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP_ELECO (Non-specific lipid-transfer protein OS=Eleusine coracana PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 7.223e-22
Identity = 51/95 (53.68%), Postives = 63/95 (66.32%), Query Frame = 1
Query:  160 AITCGQVTGSLAPCIVYLRSGGPIPVPCC-NGVRSLNAAARTTPDRQTACNC-LKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVRS 438
            AI+CGQV+ ++ PC+ Y R  G  P   C +GVRSLNAAARTT DR+ ACNC LK AA  +  LN   A  +P  CGV +PY IS S DCS+V +
Sbjct:    1 AISCGQVSSAIGPCLAYARGAGAAPSASCQSGVRSLNAAARTTADRRAACNCSLKSAASRVSGLNAGKASSIPGRCGVRLPYAISASIDCSRVNN 95          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP3_ORYSJ (Non-specific lipid-transfer protein 3 OS=Oryza sativa subsp. japonica GN=LTP110-A PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.434e-22
Identity = 52/115 (45.22%), Postives = 72/115 (62.61%), Query Frame = 1
Query:   91 MAALKLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVP-CCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            MA + LV+  V+   V    ++ A++CG VT S+APC+ Y+      P   CC+GVR+LN  A ++ DR+TAC+CLK  A S  NLN  NA  +P  CGVS+ + IS S DCSK+
Sbjct:    8 MALVALVA--VVAAAVVAERASAAVSCGDVTSSIAPCLSYVMGRESSPSSSCCSGVRTLNGKASSSADRRTACSCLKNMASSFRNLNMGNAASIPSKCGVSVAFPISTSVDCSKI 120          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP3_ORYSI (Non-specific lipid-transfer protein 3 OS=Oryza sativa subsp. indica GN=LTP110-A PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.434e-22
Identity = 52/115 (45.22%), Postives = 72/115 (62.61%), Query Frame = 1
Query:   91 MAALKLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVP-CCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            MA + LV+  V+   V    ++ A++CG VT S+APC+ Y+      P   CC+GVR+LN  A ++ DR+TAC+CLK  A S  NLN  NA  +P  CGVS+ + IS S DCSK+
Sbjct:    8 MALVALVA--VVAAAVVAERASAAVSCGDVTSSIAPCLSYVMGRESSPSSSCCSGVRTLNGKASSSADRRTACSCLKNMASSFRNLNMGNAASIPSKCGVSVAFPISTSVDCSKI 120          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP8_HORVU (Non-specific lipid-transfer protein Cw18 OS=Hordeum vulgare GN=CW18 PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.585e-21
Identity = 55/118 (46.61%), Postives = 71/118 (60.17%), Query Frame = 1
Query:   85 SQMAALKL-VSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIP-VPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            ++ AA KL + ALV  ML+    +  AITCGQV+ +L PC  Y +  G  P   CC+GV+ L   AR+T D+Q  C CLK  AG+    N   A G+P  CGVS+PY IS S DCSK+
Sbjct:    2 ARTAATKLALVALVAAMLLVA--ADAAITCGQVSSALGPCAAYAKGSGTSPSAGCCSGVKRLAGLARSTADKQATCRCLKSVAGAY---NAGRAAGIPSRCGVSVPYTISASVDCSKI 114          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP6_ARATH (Non-specific lipid-transfer protein 6 OS=Arabidopsis thaliana GN=LTP6 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.779e-20
Identity = 45/109 (41.28%), Postives = 66/109 (60.55%), Query Frame = 1
Query:  118 LVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNP---NNAVGLPRACGVSIPYKISISTDCSKVR 435
            L +C+++       A++C  V   L PC+ Y+  GGP+P  CCNG+ +L + A+T+ DRQ  C C+K A G +  L+P    NA+ LP  CGV +PYK S STDC  ++
Sbjct:    6 LAVCLVLALHCGEAAVSCNTVIADLYPCLSYVTQGGPVPTLCCNGLTTLKSQAQTSVDRQGVCRCIKSAIGGL-TLSPRTIQNALELPSKCGVDLPYKFSPSTDCDSIQ 113          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP7_ARATH (Non-specific lipid-transfer protein 7 OS=Arabidopsis thaliana GN=LTP7 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.964e-20
Identity = 54/119 (45.38%), Postives = 75/119 (63.03%), Query Frame = 1
Query:   91 MAALKLVSALVLCMLVT-GPLSAQA-ITCGQVTGSLAPCIVYLRSGG-PIPVP-CCNGVRSLNAAARTTPDRQTACNCLKQAAGSI-PNLNPNNAVGLPRACGVSIPY--KISISTDCS 426
            MA L  +  LV   ++  GP++A+A ++CG+V  +L PC  YL +GG   P P CCNGVR LN    TT DR+ AC C+K AA ++ P LN + A G+PR CG+ IPY  +I  +T C+
Sbjct:    1 MAGLMKLGCLVFVFVIAAGPITAKAALSCGEVNSNLKPCTGYLTNGGITSPGPQCCNGVRKLNGMVLTTLDRRQACRCIKNAARNVGPGLNADRAAGIPRRCGIKIPYSTQIRFNTKCN 119          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTPB_ARATH (Non-specific lipid-transfer protein 11 OS=Arabidopsis thaliana GN=LTP11 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.665e-18
Identity = 47/105 (44.76%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  118 LVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            LV+ +L+      +AI C QV   LA C+ YL++GG     CCNG+ SL AAA    DRQ ACNCLK  A +IP +N + A  LP  CGV+I    S + DC+ +
Sbjct:   14 LVITILLGIAYHGEAIACPQVNMYLAQCLPYLKAGGNPSPMCCNGLNSLKAAAPEKADRQVACNCLKSVANTIPGINDDFAKQLPAKCGVNIGVPFSKTVDCNSI 118          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTPA_ARATH (Non-specific lipid-transfer protein 10 OS=Arabidopsis thaliana GN=LTP10 PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.175e-18
Identity = 45/111 (40.54%), Postives = 63/111 (56.76%), Query Frame = 1
Query:  118 LVLCMLVTGPL---SAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAG--SIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 435
            L LC+L+       S  AI+C  V  +L PC+VY+  GG IP  CCNG+R L+  A +  D+Q  C C+K   G  S  ++    A  LP  CGV +PYKI  ST+C+ ++
Sbjct:    6 LPLCLLLASIFAWGSEAAISCNAVQANLYPCVVYVVQGGAIPYSCCNGIRMLSKQATSASDKQGVCRCIKSVVGRVSYSSIYLKKAAALPGKCGVKLPYKIDPSTNCNSIK 116          
The following BLAST results are available for this feature:
BLAST of FC920494 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLTP3_VITSX1.114e-2254.44Non-specific lipid-transfer protein P3 OS=Vitis sp... [more]
NLTP1_WHEAT2.483e-2246.49Non-specific lipid-transfer protein (Fragment) OS=... [more]
NLTP_ELECO7.223e-2253.68Non-specific lipid-transfer protein OS=Eleusine co... [more]
NLTP3_ORYSJ9.434e-2245.22Non-specific lipid-transfer protein 3 OS=Oryza sat... [more]
NLTP3_ORYSI9.434e-2245.22Non-specific lipid-transfer protein 3 OS=Oryza sat... [more]
NLTP8_HORVU3.585e-2146.61Non-specific lipid-transfer protein Cw18 OS=Hordeu... [more]
NLTP6_ARATH1.779e-2041.28Non-specific lipid-transfer protein 6 OS=Arabidops... [more]
NLTP7_ARATH3.964e-2045.38Non-specific lipid-transfer protein 7 OS=Arabidops... [more]
NLTPB_ARATH1.665e-1844.76Non-specific lipid-transfer protein 11 OS=Arabidop... [more]
NLTPA_ARATH2.175e-1840.54Non-specific lipid-transfer protein 10 OS=Arabidop... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32009B05EF RVDevelop1 Citrus clementina cDNA clone C32009B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920494 ID=FC920494|Name=FC920494|organism=Citrus clementina|type=EST|length=654bp
GACTCAACTCAAGCTTCTGAACACAGCTAGCCATAAACAAAGGCAAAAAA
AAAAAGAAAAAGAAAAAGAAAATCTCAGGAGAAATCTCAAATGGCTGCCC
TCAAGCTTGTTTCAGCTTTGGTTCTGTGCATGTTGGTGACTGGTCCCCTG
AGTGCTCAGGCCATAACATGTGGGCAGGTGACTGGCTCATTGGCACCATG
CATCGTTTACTTGAGATCGGGCGGCCCTATACCTGTGCCATGCTGCAACG
GCGTCAGGTCTCTCAACGCTGCCGCCAGAACCACACCTGACCGCCAAACT
GCATGCAACTGCTTGAAGCAAGCCGCCGGATCAATCCCTAACCTCAACCC
TAATAATGCTGTTGGTCTTCCACGAGCTTGTGGAGTCAGCATTCCTTACA
AGATCAGCATCTCCACTGACTGCTCTAAGGTCCGGTCAACAGGAATCTGG
GCTGTTGATTTTCATATTTAAGTTGACGGAGTAGAATAAATGTATAATAA
TAAGGACATTTTTGTGTCCGAATTATGAGTCTCTCTCTACACTTTGTACT
GCGAGTCTCGTTCCCGCCCTCGTTTCATGTTGTGTCTTATTGTCTTTGCT
TTTCATGTCATCGTCAGTTTGTGTCTATTCTGTTTATTAATGAAATCTTG
CCTT
back to top