FC920494

Overview
NameFC920494
Unique NameFC920494
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length654
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14378 contig Ccv1_Contig14378:3..656. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP_AMACA (Non-specific lipid-transfer protein OS=Amaranthus caudatus PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.841e-17
Identity = 44/94 (46.81%), Postives = 58/94 (61.70%), Query Frame = 1
Query:  160 AITCGQVTGSLAPCIVYLRSGGPIPVP--CCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 435
            A+TC  VT +L PC+ YL+  G  P P  CC GVRSL AAA+T  DR+ ACNC+K AA    +LN   A  L   CGV + Y +S + +C+ V+
Sbjct:    1 AVTCTVVTKALGPCMTYLKGTGATPPPANCCAGVRSLKAAAQTVADRRMACNCMKSAAQKTKSLNYKVAARLASQCGVRMSYSVSPNVNCNSVQ 94          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP1_AMAHP (Non-specific lipid-transfer protein 1 OS=Amaranthus hypochondriacus PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.841e-17
Identity = 44/94 (46.81%), Postives = 58/94 (61.70%), Query Frame = 1
Query:  160 AITCGQVTGSLAPCIVYLRSGGPIPVP--CCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 435
            A+TC  VT +L PC+ YL+  G  P P  CC GVRSL AAA+T  DR+ ACNC+K AA    +LN   A  L   CGV + Y +S + +C+ V+
Sbjct:    1 AVTCTVVTKALGPCMTYLKGTGATPPPANCCAGVRSLKAAAQTVADRRMACNCMKSAAQKTKSLNYKVAARLASQCGVRMSYSVSPNVNCNSVQ 94          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP1_HELAN (Non-specific lipid-transfer protein AP10 OS=Helianthus annuus PE=1 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 4.102e-17
Identity = 45/117 (38.46%), Postives = 66/117 (56.41%), Query Frame = 1
Query:   82 KSQMAALKLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            K     + +++ +V+  L+  P  + AITC  VTG+L PC+ YLRSGG     CC G + L  A RT  DR+TAC C K AA  +  + P+ A  LP  CG+S    I+ + +C+ +
Sbjct:    2 KGTSMGVAILAMIVMAQLMVHP--SVAITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQL-KVRPDMASSLPGKCGISTSIPINPNVNCNTI 115          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTPA_RICCO (Non-specific lipid-transfer protein A OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.117e-14
Identity = 39/91 (42.86%), Postives = 52/91 (57.14%), Query Frame = 1
Query:  163 ITCGQVTGSLAPCIVYLRSGGPIP-VPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            + CGQV  SLA CI +L  G   P   CC GV++L   A T+ DR+ AC C+K AA   P +  + A  LP+ CGV I   IS +T+C  +
Sbjct:    1 VDCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKTLAPTSADRRAACECIKAAAARFPTIKQDAASSLPKKCGVDINIPISKTTNCQAI 91          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP8_ARATH (Non-specific lipid-transfer protein 8 OS=Arabidopsis thaliana GN=LTP8 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.488e-14
Identity = 46/116 (39.66%), Postives = 63/116 (54.31%), Query Frame = 1
Query:   91 MAALKLVSAL-VLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSG-GPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            M  LK ++ + VL +      S  AI+C  V   L PC+ YL SG G  P  CC+GV+SL AA  T+ D++ AC C+K  A S+  + P  A  L   CG S+P   S + DC+ V
Sbjct:    1 MNVLKCLAIISVLGIFFIPRYSESAISCSVVLQDLQPCVSYLTSGSGNPPETCCDGVKSLAAATTTSADKKAACQCIKSVANSV-TVKPELAQALASNCGASLPVDASPTVDCTTV 115          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTP_PINTA (Non-specific lipid-transfer protein OS=Pinus taeda PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.593e-13
Identity = 45/120 (37.50%), Postives = 62/120 (51.67%), Query Frame = 1
Query:   82 KSQMAALKLVSALVLCMLVTGPLSAQ-AITCGQVTGSLAPCIVYLRSGGPIPVP-CCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVS-IPYKISISTDCSKV 432
            K  + A+ +V  +V  M V G +  + AI+C QV  ++ PC  YL      P   CC  +R L++  + TPDRQ  CNCLK  A S   +    A  LP  C V+ +   IS + DCSKV
Sbjct:    4 KKMVEAVFVVGLVVTMMNVWGAVPVEGAISCNQVVSAMTPCATYLIGNAATPAATCCPSIRGLDSQVKATPDRQAVCNCLKTQAKSY-GVKLGKAANLPGLCKVTDLNVPISPNVDCSKV 122          
BLAST of FC920494 vs. ExPASy Swiss-Prot
Match: NLTPB_RICCO (Non-specific lipid-transfer protein B OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.189e-12
Identity = 35/91 (38.46%), Postives = 50/91 (54.95%), Query Frame = 1
Query:  163 ITCGQVTGSLAPCIVYLRSGGPIP-VPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKV 432
            + CGQV  +L+ C+ +L      P + CC GV  L   A T  D++ AC C+K AA   PN+  + A  LP  CGV I   IS +T+C ++
Sbjct:    1 VNCGQVNKALSSCVPFLTGFDTTPSLTCCAGVMELKRLAPTVKDKRIACECVKTAAARYPNIREDAASSLPYKCGVVINVPISKTTNCHEI 91          
The following BLAST results are available for this feature:
BLAST of FC920494 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLTP_AMACA1.841e-1746.81Non-specific lipid-transfer protein OS=Amaranthus ... [more]
NLTP1_AMAHP1.841e-1746.81Non-specific lipid-transfer protein 1 OS=Amaranthu... [more]
NLTP1_HELAN4.102e-1738.46Non-specific lipid-transfer protein AP10 OS=Helian... [more]
NLTPA_RICCO1.117e-1442.86Non-specific lipid-transfer protein A OS=Ricinus c... [more]
NLTP8_ARATH2.488e-1439.66Non-specific lipid-transfer protein 8 OS=Arabidops... [more]
NLTP_PINTA3.593e-1337.50Non-specific lipid-transfer protein OS=Pinus taeda... [more]
NLTPB_RICCO5.189e-1238.46Non-specific lipid-transfer protein B OS=Ricinus c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32009B05EF RVDevelop1 Citrus clementina cDNA clone C32009B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920494 ID=FC920494|Name=FC920494|organism=Citrus clementina|type=EST|length=654bp
GACTCAACTCAAGCTTCTGAACACAGCTAGCCATAAACAAAGGCAAAAAA
AAAAAGAAAAAGAAAAAGAAAATCTCAGGAGAAATCTCAAATGGCTGCCC
TCAAGCTTGTTTCAGCTTTGGTTCTGTGCATGTTGGTGACTGGTCCCCTG
AGTGCTCAGGCCATAACATGTGGGCAGGTGACTGGCTCATTGGCACCATG
CATCGTTTACTTGAGATCGGGCGGCCCTATACCTGTGCCATGCTGCAACG
GCGTCAGGTCTCTCAACGCTGCCGCCAGAACCACACCTGACCGCCAAACT
GCATGCAACTGCTTGAAGCAAGCCGCCGGATCAATCCCTAACCTCAACCC
TAATAATGCTGTTGGTCTTCCACGAGCTTGTGGAGTCAGCATTCCTTACA
AGATCAGCATCTCCACTGACTGCTCTAAGGTCCGGTCAACAGGAATCTGG
GCTGTTGATTTTCATATTTAAGTTGACGGAGTAGAATAAATGTATAATAA
TAAGGACATTTTTGTGTCCGAATTATGAGTCTCTCTCTACACTTTGTACT
GCGAGTCTCGTTCCCGCCCTCGTTTCATGTTGTGTCTTATTGTCTTTGCT
TTTCATGTCATCGTCAGTTTGTGTCTATTCTGTTTATTAATGAAATCTTG
CCTT
back to top