FC920648

Overview
NameFC920648
Unique NameFC920648
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14142 contig Ccv1_Contig14142:258..944. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920648 vs. ExPASy Swiss-Prot
Match: P4HA2_HUMAN (Prolyl 4-hydroxylase subunit alpha-2 OS=Homo sapiens GN=P4HA2 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.139e-12
Identity = 45/149 (30.20%), Postives = 76/149 (51.01%), Query Frame = 1
Query:  151 IINPSKVKQISWKPRAFVYEGFLTDLECDHLINLAKSQLKRSAVADNLSGESKLSDVRTSSGTFIPKGKDAIIAGIEDKIATWTFLPKENGEDIQVLRCEHGQKYEPHYDYF----SDKVNIVRGGHRLATVLMYLSDVAKGGETVFPN 585
            +I P K +     P    Y   ++D E + +  +AK +L R+ V D  +G   ++  R S  +++ +  D ++A +  ++   T L  +  E +QV     G +YEPH+D+      D    +  G+R+AT L Y+SDV  GG TVFP+
Sbjct:  323 LIAPFKEEDEWDSPHIVRYYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVANYGVGGQYEPHFDFSRNDERDTFKHLGTGNRVATFLNYMSDVEAGGATVFPD 471          
BLAST of FC920648 vs. ExPASy Swiss-Prot
Match: P4HA3_RAT (Prolyl 4-hydroxylase subunit alpha-3 OS=Rattus norvegicus GN=P4ha3 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.260e-11
Identity = 47/149 (31.54%), Postives = 80/149 (53.69%), Query Frame = 1
Query:  151 IINPSKVKQISWKPRAFVYEGFLTDLECDHLINLAKSQLKRSAVADNLSGESKLS-DVRTSSGTFIPKGKDAIIAGIEDKIATWTFLPKEN--GEDIQVLRCEHGQKYEPHYDYF---SDKVNIVRGGHRLATVLMYLSDVAKGGETVF 579
            ++ P++ + I  +P   +Y  F++D E   +  LA+  L+RS VA   SGE +L  + R S   ++    D ++  ++ +IA  T L  +    E +QV+    G  YEPH+D+    S  +  ++ G+R AT+++YLS V  GG T F
Sbjct:  333 LLQPARKEVIHLRPLVALYHDFVSDEEAQKIRELAEPWLQRSVVA---SGEKQLQVEYRISKSAWLKDTVDPVLVTLDRRIAALTGLDIQPPYAEYLQVVNYGIGGHYEPHFDHATSPSSPLYKMKSGNRAATLMIYLSSVEAGGATAF 478          
BLAST of FC920648 vs. ExPASy Swiss-Prot
Match: P4HA3_MOUSE (Prolyl 4-hydroxylase subunit alpha-3 OS=Mus musculus GN=P4ha3 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.806e-11
Identity = 46/149 (30.87%), Postives = 80/149 (53.69%), Query Frame = 1
Query:  151 IINPSKVKQISWKPRAFVYEGFLTDLECDHLINLAKSQLKRSAVADNLSGESKLS-DVRTSSGTFIPKGKDAIIAGIEDKIATWTFLPKEN--GEDIQVLRCEHGQKYEPHYDYF---SDKVNIVRGGHRLATVLMYLSDVAKGGETVF 579
            ++ P++ + +  +P   +Y  F++D E   +  LA+  L+RS VA   SGE +L  + R S   ++    D ++  ++ +IA  T L  +    E +QV+    G  YEPH+D+    S  +  ++ G+R+AT ++YLS V  GG T F
Sbjct:  331 LLQPARKEVVHLRPLIALYHDFVSDEEAQKIRELAEPWLQRSVVA---SGEKQLQVEYRISKSAWLKDTVDPMLVTLDHRIAALTGLDIQPPYAEYLQVVNYGIGGHYEPHFDHATSPSSPLYRMKSGNRVATFMIYLSSVEAGGATAF 476          
BLAST of FC920648 vs. ExPASy Swiss-Prot
Match: P4HA3_BOVIN (Prolyl 4-hydroxylase subunit alpha-3 OS=Bos taurus GN=P4HA3 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.806e-11
Identity = 47/149 (31.54%), Postives = 78/149 (52.35%), Query Frame = 1
Query:  151 IINPSKVKQISWKPRAFVYEGFLTDLECDHLINLAKSQLKRSAVADNLSGESKLS-DVRTSSGTFIPKGKDAIIAGIEDKIATWTFLPKEN--GEDIQVLRCEHGQKYEPHYDYF---SDKVNIVRGGHRLATVLMYLSDVAKGGETVF 579
            ++ P + + I  +P   +Y  F++D E   +  LA+  L+RS VA   SGE +L  + R S   ++    D ++  ++ +IA  T L  +    E +QV+    G  YEPH+D+    S  +  +  G+R+AT ++YLS V  GG T F
Sbjct:  333 LLQPVRKEVIHLEPYVVLYHDFVSDAEAQTIRGLAEPWLQRSVVA---SGEKQLPVEYRISKSAWLKDTVDPVLVTLDHRIAALTGLDVQPPYAEYLQVVNYGIGGHYEPHFDHATSPSSPLYRMNSGNRVATFMIYLSSVEAGGATAF 478          
The following BLAST results are available for this feature:
BLAST of FC920648 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
P4HA2_HUMAN1.139e-1230.20Prolyl 4-hydroxylase subunit alpha-2 OS=Homo sapie... [more]
P4HA3_RAT1.260e-1131.54Prolyl 4-hydroxylase subunit alpha-3 OS=Rattus nor... [more]
P4HA3_MOUSE2.806e-1130.87Prolyl 4-hydroxylase subunit alpha-3 OS=Mus muscul... [more]
P4HA3_BOVIN2.806e-1131.54Prolyl 4-hydroxylase subunit alpha-3 OS=Bos taurus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011C04EF RVDevelop1 Citrus clementina cDNA clone C32011C04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920648 ID=FC920648|Name=FC920648|organism=Citrus clementina|type=EST|length=687bp
GGAGTTTAACATTTTGTCGGATAATCTCAAATCCCTCGTCTCTCATAATC
GATCCAATCCACGCTCATGTCTCCCACAAGGCTCTCTCTAAATTTCTTCT
TCCTGCTCTCCTTCTCGTTGTTAATTCGCAAATCTTTCAGCTCTACCGCC
ATTATCAACCCATCTAAAGTCAAACAAATTTCTTGGAAACCCAGGGCCTT
TGTGTACGAGGGTTTTCTCACAGACTTAGAATGCGATCACTTGATTAATC
TTGCAAAATCTCAGCTGAAGAGATCAGCAGTTGCTGATAATTTGAGTGGA
GAGAGCAAGCTGAGCGATGTTCGAACAAGTTCTGGGACCTTTATACCTAA
AGGAAAGGATGCTATTATTGCTGGTATAGAGGACAAGATTGCAACATGGA
CGTTTCTTCCAAAAGAAAATGGGGAAGACATACAAGTACTAAGGTGTGAG
CACGGACAGAAATATGAACCACATTATGATTACTTCTCTGACAAGGTTAA
TATTGTTCGGGGCGGACACCGCCTAGCAACTGTGCTAATGTATCTTTCCG
ATGTTGCTAAAGGTGGTGAGACAGTATTTCCCAATGCTGAGGAACCTCCA
CGTCGCAGAACTCCTGCTACCAATGACGATCTTTCTGAATGTGCTAAGAA
AGGAATTGCAGTGAAGCCACGAAGAAGGGATGCTCTT
back to top