FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_RAT (Heat shock cognate 71 kDa protein OS=Rattus norvegicus GN=Hspa8 PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.067e-41
Identity = 86/112 (76.79%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   59 VAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_PONAB (Heat shock cognate 71 kDa protein OS=Pongo abelii GN=HSPA8 PE=2 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 1.067e-41
Identity = 86/112 (76.79%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   59 VAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLAKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_MOUSE (Heat shock cognate 71 kDa protein OS=Mus musculus GN=Hspa8 PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.067e-41
Identity = 86/112 (76.79%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   59 VAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_HUMAN (Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.067e-41
Identity = 86/112 (76.79%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   59 VAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_HORSE (Heat shock cognate 71 kDa protein OS=Equus caballus GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.067e-41
Identity = 86/112 (76.79%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   59 VAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_CRIGR (Heat shock cognate 71 kDa protein OS=Cricetulus griseus GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.067e-41
Identity = 86/112 (76.79%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   59 VAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGEAKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_BOVIN (Heat shock cognate 71 kDa protein OS=Bos taurus GN=HSPA8 PE=1 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 1.067e-41
Identity = 86/112 (76.79%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   59 VAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_LEIMA (Heat shock 70 kDa protein (Fragment) OS=Leishmania major GN=HSP70 PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.394e-41
Identity = 84/112 (75.00%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F+D+ VQ DMK WPFKV     DKP+I V Y+GEEK F  EEISSMVL+KM+E AEAYLG  +K AVVTVPAYFNDSQRQATKDAG IAGL V
Sbjct:   59 VAMNPHNTVFDAKRLIGRKFNDSVVQSDMKHWPFKVTTKGDDKPVISVQYRGEEKTFTPEEISSMVLLKMKETAEAYLGKQVKKAVVTVPAYFNDSQRQATKDAGTIAGLEV 170          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_USTMA (Heat shock 70 kDa protein 2 OS=Ustilago maydis GN=UMS2 PE=3 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 2.377e-41
Identity = 84/112 (75.00%), Postives = 94/112 (83.93%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F DA VQ DMK WPF+V +    KP I + YKGE+K F  EEISSMVL+KMRE AEAYLG T+K+AVVTVPAYFNDSQRQATKDAG+I+GLNV
Sbjct:   57 VAMNPHNTVFDAKRLIGRKFDDAEVQSDMKHWPFEVTS-VGGKPQIRIEYKGEKKTFTPEEISSMVLLKMRETAEAYLGGTVKDAVVTVPAYFNDSQRQATKDAGIISGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS71B_MOUSE (Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hspa1b PE=1 SV=3)

HSP 1 Score: 167.162 bits (422), Expect = 2.377e-41
Identity = 84/112 (75.00%), Postives = 93/112 (83.04%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA+NP NTVFDAKRLIGR+F DA VQ DMK WPF+V+    DKP + VNYKGE + F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   59 VALNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVV-NDGDKPKVQVNYKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 169          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP7C_RAT1.067e-4176.79Heat shock cognate 71 kDa protein OS=Rattus norveg... [more]
HSP7C_PONAB1.067e-4176.79Heat shock cognate 71 kDa protein OS=Pongo abelii ... [more]
HSP7C_MOUSE1.067e-4176.79Heat shock cognate 71 kDa protein OS=Mus musculus ... [more]
HSP7C_HUMAN1.067e-4176.79Heat shock cognate 71 kDa protein OS=Homo sapiens ... [more]
HSP7C_HORSE1.067e-4176.79Heat shock cognate 71 kDa protein OS=Equus caballu... [more]
HSP7C_CRIGR1.067e-4176.79Heat shock cognate 71 kDa protein OS=Cricetulus gr... [more]
HSP7C_BOVIN1.067e-4176.79Heat shock cognate 71 kDa protein OS=Bos taurus GN... [more]
HSP70_LEIMA1.394e-4175.00Heat shock 70 kDa protein (Fragment) OS=Leishmania... [more]
HSP72_USTMA2.377e-4175.00Heat shock 70 kDa protein 2 OS=Ustilago maydis GN=... [more]
HS71B_MOUSE2.377e-4175.00Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hs... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top