FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_ANOAL (Heat shock protein 70 A1 OS=Anopheles albimanus GN=HSP70A1 PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 9.033e-41
Identity = 83/112 (74.11%), Postives = 91/112 (81.25%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGR+F D  +Q DMK WPF V+     KP I V +KGE K FA EEISSMVL KM+E AEAYLG ++KNAV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   57 VAMNPTNTVFDAKRLIGRKFDDPKIQADMKHWPFTVV-NDCGKPKIRVEFKGERKTFAPEEISSMVLTKMKETAEAYLGQSVKNAVITVPAYFNDSQRQATKDAGAIAGLNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_ONCMY (Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2)

HSP 1 Score: 165.236 bits (417), Expect = 9.033e-41
Identity = 84/112 (75.00%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGRRF D  VQ DMK WPF+VI   + +P + V YKGE K F  EEISSMVL+KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG I+GLNV
Sbjct:   59 VAMNPCNTVFDAKRLIGRRFDDGVVQSDMKHWPFEVI-NDSTRPKLQVEYKGETKSFYPEEISSMVLVKMKEIAEAYLGKTVNNAVVTVPAYFNDSQRQATKDAGTISGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS71A_PIG (Heat shock 70 kDa protein 1A OS=Sus scrofa GN=HSPA1A PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 9.033e-41
Identity = 84/112 (75.00%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA+NP NTVFDAKRLIGR+F D  VQGDMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAE YLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   59 VALNPQNTVFDAKRLIGRKFGDPVVQGDMKHWPFRVI-NDGDKPKVQVSYKGETKGFYPEEISSMVLTKMKEIAEGYLGHPVSNAVITVPAYFNDSQRQATKDAGVIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_PLACB (Heat shock 70 kDa protein OS=Plasmodium cynomolgi (strain Berok) PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.180e-40
Identity = 83/112 (74.11%), Postives = 96/112 (85.71%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA NP NTVFDAKRLIGR+F+++SVQ DMK WPF V +G  +KPMI V+Y+GE+K F  EEISSMVL KM+E AEA+LG +IKNAV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   70 VARNPENTVFDAKRLIGRKFTESSVQSDMKHWPFTVKSGVDEKPMIEVSYQGEKKLFHPEEISSMVLQKMKENAEAFLGKSIKNAVITVPAYFNDSQRQATKDAGTIAGLNV 181          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS71L_PIG (Heat shock 70 kDa protein 1-like OS=Sus scrofa GN=HSPA1L PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.180e-40
Identity = 84/112 (75.00%), Postives = 94/112 (83.93%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F+D  VQ DMKLWPF+VI     KP + V+YKGE+K F  EEISSMVL KM+E AEA+LG T+ NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   61 VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVI-NEGGKPKVMVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGYTVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS71L_BOVIN (Heat shock 70 kDa protein 1-like OS=Bos taurus GN=HSPA1L PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.180e-40
Identity = 84/112 (75.00%), Postives = 94/112 (83.93%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F+D  VQ DMKLWPF+VI     KP + V+YKGE+K F  EEISSMVL KM+E AEA+LG T+ NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   61 VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVI-NEGGKPKVMVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGYTVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS71B_PIG (Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA1B PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.180e-40
Identity = 84/112 (75.00%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   59 VALNPQNTVFDAKRLIGRKFGDPVVQADMKHWPFRVI-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGHPVSNAVITVPAYFNDSQRQATKDAGVIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7D_MANSE (Heat shock 70 kDa protein cognate 4 OS=Manduca sexta PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.541e-40
Identity = 81/112 (72.32%), Postives = 94/112 (83.93%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NT+FDAKRLIGR+F DA+VQ DMK WPF+V++    KP I V YKGE+K F  EE+SSMVL KM+E AEAYLG T++NAV+TVPAYFNDSQRQATKDAG I+GLNV
Sbjct:   59 VAMNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQATKDAGTISGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_PLAFA (Heat shock 70 kDa protein OS=Plasmodium falciparum PE=2 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 1.541e-40
Identity = 83/112 (74.11%), Postives = 95/112 (84.82%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA NP NTVFDAKRLIGR+F+++SVQ DMK WPF V +G  +KPMI V Y+GE+K F  EEISSMVL KM+E AEA+LG +IKNAV+TVPAYFNDSQRQATKDAG IAGLNV
Sbjct:   70 VARNPENTVFDAKRLIGRKFTESSVQSDMKHWPFTVKSGVDEKPMIEVTYQGEKKLFHPEEISSMVLQKMKENAEAFLGKSIKNAVITVPAYFNDSQRQATKDAGTIAGLNV 181          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_LEIAM (Heat shock 70 kDa protein OS=Leishmania amazonensis GN=HSP70 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.541e-40
Identity = 82/112 (73.21%), Postives = 91/112 (81.25%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F+D  VQ DMK WPFKV     DKP+I V Y+GEEK F  E+ISSMVL+KM+E AEAYLG  +K AVVTVPAYFNDSQRQATKDAG I+GL V
Sbjct:   59 VAMNPHNTVFDAKRLIGRKFNDLVVQSDMKHWPFKVTTKGDDKPVISVQYRGEEKTFTPEKISSMVLLKMKETAEAYLGKQVKKAVVTVPAYFNDSQRQATKDAGTISGLEV 170          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP71_ANOAL9.033e-4174.11Heat shock protein 70 A1 OS=Anopheles albimanus GN... [more]
HSP70_ONCMY9.033e-4175.00Heat shock cognate 70 kDa protein OS=Oncorhynchus ... [more]
HS71A_PIG9.033e-4175.00Heat shock 70 kDa protein 1A OS=Sus scrofa GN=HSPA... [more]
HSP70_PLACB1.180e-4074.11Heat shock 70 kDa protein OS=Plasmodium cynomolgi ... [more]
HS71L_PIG1.180e-4075.00Heat shock 70 kDa protein 1-like OS=Sus scrofa GN=... [more]
HS71L_BOVIN1.180e-4075.00Heat shock 70 kDa protein 1-like OS=Bos taurus GN=... [more]
HS71B_PIG1.180e-4075.00Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA... [more]
HSP7D_MANSE1.541e-4072.32Heat shock 70 kDa protein cognate 4 OS=Manduca sex... [more]
HSP70_PLAFA1.541e-4074.11Heat shock 70 kDa protein OS=Plasmodium falciparum... [more]
HSP70_LEIAM1.541e-4073.21Heat shock 70 kDa protein OS=Leishmania amazonensi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top