FC920665

Overview
NameFC920665
Unique NameFC920665
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14114 contig Ccv1_Contig14114:11..697. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALF2_CAEEL (Fructose-bisphosphate aldolase 2 OS=Caenorhabditis elegans GN=aldo-2 PE=1 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.325e-37
Identity = 80/140 (57.14%), Postives = 98/140 (70.00%), Query Frame = 2
Query:  251 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSI 670
            DEL + A  +   G+GILA DES  T GKRL +I LEN E NRQ YR LL T P L Q+ISG IL+EET +QST  G+K  D+L++Q IVPGIK+D G+VPLAG+  E   QGLD LA R AA+ + G  FAKWR V++I
Sbjct:   18 DELHQIALKIVQDGKGILAADESTGTIGKRLDAINLENNETNRQKYRQLLFTTPNLNQHISGVILYEETFHQSTDKGEKFTDLLIKQGIVPGIKLDLGVVPLAGTIGEGTTQGLDKLAERAAAFKKGGCGFAKWRCVLNI 157          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALF1_XYLFT (Probable fructose-bisphosphate aldolase class 1 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=PD_1845 PE=3 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.465e-36
Identity = 75/140 (53.57%), Postives = 98/140 (70.00%), Query Frame = 2
Query:  251 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSI 670
            ++L +TA+ + + G+GI+A+DES  T  KR +S+G+EN E NR+AYR LL+T P L  YISGAILF+ET+ QST  G      + E  I+PGIKVDKG  PLAG   E   +GLDGL +R   YY+ GARFAKWR V++I
Sbjct:    4 EQLAETAQAMVASGKGIIAIDESAGTIAKRFSSVGIENIEENRRAYRELLLTTPKLSDYISGAILFDETIRQSTKAGVPFPKYMAEHGIIPGIKVDKGAYPLAGCPGELVTEGLDGLRARLEEYYKLGARFAKWRAVINI 143          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALF1_CAEEL (Fructose-bisphosphate aldolase 1 OS=Caenorhabditis elegans GN=aldo-1 PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.465e-36
Identity = 81/141 (57.45%), Postives = 96/141 (68.09%), Query Frame = 2
Query:  251 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPG-LGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSI 670
            DEL   A  + +PG+GILA DES  +  KRL SIGLENTE NR+ YR LL TA   L +YISG I+F ET YQ T DGK    +L EQ I+PGIKVDKG+VP+AG+  E   QGLD L +R A Y + GA+FAKWR V  I
Sbjct:   14 DELRSIANAIVTPGKGILAADESTGSMDKRLNSIGLENTEENRRKYRQLLFTAGADLNKYISGVIMFHETFYQKTDDGKPFTALLQEQGIIPGIKVDKGVVPMAGTIGEGTTQGLDDLNARCAQYKKDGAQFAKWRCVHKI 154          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALF_PLAFA (Fructose-bisphosphate aldolase OS=Plasmodium falciparum PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.913e-36
Identity = 80/141 (56.74%), Postives = 99/141 (70.21%), Query Frame = 2
Query:  248 ADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSI 670
            A+EL  TA+ +   G+GILA DES  T  KR  +I LENT  NR +YR LL    GLG++ISGAILFEETL+Q    G  MV++L  +NI+PGIKVDKGLV +  +++E   QGLDGLA R   YY+ GARFAKWRTV+ I
Sbjct:   19 AEELATTAQKLVQAGKGILAADESTQTIKKRFDNIKLENTIENRASYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPMVNLLHNENIIPGIKVDKGLVNIPCTDEEKSTQGLDGLAERCKEYYKAGARFAKWRTVLVI 159          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALF_PLAF7 (Fructose-bisphosphate aldolase OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0425 PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.913e-36
Identity = 80/141 (56.74%), Postives = 99/141 (70.21%), Query Frame = 2
Query:  248 ADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSI 670
            A+EL  TA+ +   G+GILA DES  T  KR  +I LENT  NR +YR LL    GLG++ISGAILFEETL+Q    G  MV++L  +NI+PGIKVDKGLV +  +++E   QGLDGLA R   YY+ GARFAKWRTV+ I
Sbjct:   19 AEELATTAQKLVQAGKGILAADESTQTIKKRFDNIKLENTIENRASYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPMVNLLHNENIIPGIKVDKGLVNIPCTDEEKSTQGLDGLAERCKEYYKAGARFAKWRTVLVI 159          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALF_DROME (Fructose-bisphosphate aldolase OS=Drosophila melanogaster GN=Ald PE=1 SV=5)

HSP 1 Score: 151.754 bits (382), Expect = 3.264e-36
Identity = 83/147 (56.46%), Postives = 100/147 (68.03%), Query Frame = 2
Query:  251 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLV-TAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSI-PNGPS 685
            DEL + A+ + +PG+GILA DES  T GKRL  IG+ENTE NR+AYR LL  T P L + ISG ILF ETLYQ   DG    ++L ++ I+ GIKVDKG+VPL GS DE   QGLD LA+R A Y + G  FAKWR V+ I  N PS
Sbjct:   14 DELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPS 160          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALF1_XYLFA (Probable fructose-bisphosphate aldolase class 1 OS=Xylella fastidiosa GN=XF_0826 PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 3.264e-36
Identity = 74/140 (52.86%), Postives = 98/140 (70.00%), Query Frame = 2
Query:  251 DELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSI 670
            ++L +TA+ + + G+GI+A+DES  T  KR +S+G+EN E NR+AYR LL+T P L  YISGAILF+ET+ QST  G      + +  I+PGIKVDKG  PLAG   E   +GLDGL +R   YY+ GARFAKWR V++I
Sbjct:    4 EQLAETAQAMVASGKGIIAIDESAGTIAKRFSSVGIENIEENRRAYRELLLTTPKLSDYISGAILFDETIRQSTKAGVPFPKYMADHGIIPGIKVDKGAYPLAGCPGELVTEGLDGLRARLEEYYKLGARFAKWRAVINI 143          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALF2_PLABA (Fructose-bisphosphate aldolase 2 OS=Plasmodium berghei (strain Anka) GN=ALDO2 PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 4.262e-36
Identity = 78/141 (55.32%), Postives = 99/141 (70.21%), Query Frame = 2
Query:  248 ADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSI 670
            A EL +TAK + + G+GILA DES  T  KR  +I +ENT  NR +YR LL    GLG++ISGAILFEETL+Q    G  +V++L ++ I+PGIKVDKGLV +  ++DE   QGLDGLA R   YY+ GARFAKWR V+ I
Sbjct:    8 AQELAETAKKLVAAGKGILAADESTQTIKKRFDNIKIENTVQNRASYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPLVNLLHDEGIIPGIKVDKGLVSIPCTDDEKSTQGLDGLAERCKEYYKAGARFAKWRAVLVI 148          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALF1_LAMJA (Fructose-bisphosphate aldolase, muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 3.055e-34
Identity = 78/146 (53.42%), Postives = 97/146 (66.44%), Query Frame = 2
Query:  254 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTA-PGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSI-PNGPS 685
            EL   A+ + + G+GILA DES  T GKRL  IGLENT+ +R+ YR LL T  P + ++I G I F ET+YQ T  G   V ++ +  I+ GIKVDKG+VPLAG+N E   QGLDGLA R A Y + GA FAKWR V+ I PN PS
Sbjct:   15 ELADIAQRIVASGKGILAADESVGTMGKRLTQIGLENTDEHRRFYRQLLFTTDPSIKEHIGGIIFFHETMYQKTDGGVPFVKLVKDNGILVGIKVDKGVVPLAGTNGEGTTQGLDGLAERCAQYKKDGADFAKWRCVLKISPNTPS 160          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALF2_LAMJA (Fructose-bisphosphate aldolase, non-muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 5.210e-34
Identity = 78/146 (53.42%), Postives = 100/146 (68.49%), Query Frame = 2
Query:  254 ELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTA-PGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSI-PNGPS 685
            EL + A+ + S G+GILA DES  T GKRL++I +EN + NR+ YR LL ++ P + + I G I +EETLYQ T DG   V ++ ++ IV GIKVDKG VPLAG++ ES  QGLDGLA R A Y + GA FAKWR V+ I  N PS
Sbjct:   15 ELAEIAQRIVSNGKGILAADESTGTMGKRLSAIKVENVDENRRVYRQLLFSSDPSVTKAIGGVIFYEETLYQKTDDGTPFVKLIKDRGIVVGIKVDKGTVPLAGTDGESTTQGLDGLAERCARYKKDGADFAKWRCVLKISKNTPS 160          
The following BLAST results are available for this feature:
BLAST of FC920665 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALF2_CAEEL1.325e-3757.14Fructose-bisphosphate aldolase 2 OS=Caenorhabditis... [more]
ALF1_XYLFT1.465e-3653.57Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF1_CAEEL1.465e-3657.45Fructose-bisphosphate aldolase 1 OS=Caenorhabditis... [more]
ALF_PLAFA1.913e-3656.74Fructose-bisphosphate aldolase OS=Plasmodium falci... [more]
ALF_PLAF71.913e-3656.74Fructose-bisphosphate aldolase OS=Plasmodium falci... [more]
ALF_DROME3.264e-3656.46Fructose-bisphosphate aldolase OS=Drosophila melan... [more]
ALF1_XYLFA3.264e-3652.86Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF2_PLABA4.262e-3655.32Fructose-bisphosphate aldolase 2 OS=Plasmodium ber... [more]
ALF1_LAMJA3.055e-3453.42Fructose-bisphosphate aldolase, muscle type OS=Lam... [more]
ALF2_LAMJA5.210e-3453.42Fructose-bisphosphate aldolase, non-muscle type OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D12EF RVDevelop1 Citrus clementina cDNA clone C32011D12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920665 ID=FC920665|Name=FC920665|organism=Citrus clementina|type=EST|length=687bp
AGGCAGAAGAAAGACAGTGAAGATAAGATTATAAGTGCTATAAGCTAAGG
CCTCTCGAGCTCAGAACCCACAGCAAGAAGAAGCAAAGAGGAAAATGGCC
TCAGCCTCGGCATCTTTACTCAAGTCATCATCCCCCGTTCTTGACAAGTC
TGAGTGGGTTAAGGGCCAGGCCATCCGCCAGTCTACTGTCTCAGTCCGCA
GCCTCCCCAGTGGCCCCTCTTCCCTCACCATCCGTGCTGGTTCCTATGCC
GATGAGCTTGTCAAGACCGCGAAAACTGTTGCATCACCAGGACGTGGAAT
TTTGGCCATGGATGAGTCAAATGCAACTTGTGGAAAACGCCTTGCCTCAA
TTGGGTTAGAGAACACTGAGGCTAACCGCCAGGCATACCGTACCCTCCTT
GTTACAGCCCCTGGTCTTGGACAGTACATCTCTGGTGCCATCCTTTTTGA
GGAGACTCTCTACCAATCCACCACCGATGGCAAGAAGATGGTCGATGTTC
TTGTTGAGCAAAACATTGTCCCCGGTATCAAAGTCGACAAGGGTTTGGTG
CCCCTTGCTGGTTCCAATGATGAGTCATGGTGCCAGGGTCTTGATGGCCT
GGCTTCTCGCACTGCTGCCTACTACGAACAGGGAGCTCGTTTCGCCAAAT
GGCGTACTGTTGTGAGCATTCCCAATGGCCCATCTGC
back to top