FC920672

Overview
NameFC920672
Unique NameFC920672
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length748
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14102 contig Ccv1_Contig14102:4..752. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PRS8_BOVIN (26S protease regulatory subunit 8 OS=Bos taurus GN=PSMC5 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 9.769e-16
Identity = 44/131 (33.59%), Postives = 73/131 (55.73%), Query Frame = 1
Query:  286 LVSDKQMMQEEQPLQVARCTKIISPNSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            L+ ++  + +EQ   V    + +    +  K ++ V    KFVV +   +   D+    RV +  + Y +   LP K+DP V++M VE+ PD TY  +GG  +QI++++EV+ELP+ HPE F  LGI  P+
Sbjct:   58 LLREELQLLQEQGSYVGEVVRAM----DKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPK 184          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PSMR_METM7 (Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pan PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.276e-15
Identity = 53/179 (29.61%), Postives = 89/179 (49.72%), Query Frame = 1
Query:  169 YSTSIKKAEKEIKDMAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIISP---------NSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            YST I+K + ++K+  +K   +  ++     L   ++ D+  +   +++E  +      K+  P            + K V+       F+V L   V P DI  G RV +++    I   LP + D     M +EEKPD+++ D+GG   QI  ++EVVELP+ +PE F K+GI PP+
Sbjct:    7 YSTDIEKNKMDLKEFKEKTQ-IAELESKVLRLELKNK-DVTRENVQIKKENEILKRELDKLRIPPLILGTILDKVNERKAVVKSSTGPNFLVNLSQFVDPEDIVPGARVCLNQQTLAIVEVLPKEKDYRAMAMEIEEKPDISFEDIGGLNNQIRDIKEVVELPLKNPELFEKVGIVPPK 183          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PSMR_METVS (Proteasome-activating nucleotidase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pan PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.666e-15
Identity = 53/179 (29.61%), Postives = 88/179 (49.16%), Query Frame = 1
Query:  169 YSTSIKKAEKEIKDMAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIISP---------NSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            YST ++K E ++K+  +K   L  ++     L   ++ D+  +   +++E  +      K+  P            + K V+       F+V L   V P DI  G RV +++    +   LP + D     M +EEKPD+ + D+GG   QI  ++EVVELP+ +PE F K+GI PP+
Sbjct:    7 YSTDVQKNEMDLKEFKEKAY-LAELESKVLRLELKNK-DITRENVQIKKENEILKRELDKLRIPPLILGTVLDRVNERKAVVKSSTGPNFLVNLSQFVEPDDIVPGARVCLNQQTLAVVEVLPKEKDYRAMAMELEEKPDILFGDIGGLNNQIRDIKEVVELPLKNPELFEKVGIVPPK 183          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PSMR_METM5 (Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pan PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.666e-15
Identity = 53/179 (29.61%), Postives = 89/179 (49.72%), Query Frame = 1
Query:  169 YSTSIKKAEKEIKDMAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIISP---------NSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            YST I+K + ++K+  +K   +  ++     L   ++ D+  +   +++E  +      K+  P            + K V+       F+V L   V P DI  G RV +++    I   LP + D     M +EEKPD+++ D+GG   QI  ++EVVELP+ +PE F K+GI PP+
Sbjct:    7 YSTDIEKNKMDLKEFKEKTQ-IAELESKVLRLELKNK-DISRENVQIKKENEILKRELDKLRIPPLILGTILDRVNERKAVVKSSTGPNFLVNLSQFVDPDDIVPGARVCLNQQTLAIVEVLPKEKDYRAMAMEIEEKPDISFEDIGGLNNQIRDIKEVVELPLKNPELFEKVGIVPPK 183          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PRS10_SCHPO (Probable 26S protease subunit rpt4 OS=Schizosaccharomyces pombe GN=rpt4 PE=2 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 1.666e-15
Identity = 36/104 (34.62%), Postives = 66/104 (63.46%), Query Frame = 1
Query:  367 EDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            +  ++++      ++VVG  + V  + + +G+RV +D     I   LP ++DP V  M++E+  D+++  VGG  EQI ++REV+ELP+ +PE F+++GI PP+
Sbjct:   64 DSERFIVKASSGPRYVVGCRNNVDQSHLVQGVRVSLDMTTLTIMRILPREVDPLVYNMSIEDPGDISFAGVGGLNEQIRELREVIELPLKNPELFLRVGIKPPK 167          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PSMR_THEON (Proteasome-activating nucleotidase OS=Thermococcus onnurineus (strain NA1) GN=pan PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.176e-15
Identity = 38/91 (41.76%), Postives = 60/91 (65.93%), Query Frame = 1
Query:  406 KFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            +FVV +   +   +++ G RV +D+    I   LP + DPSV    V E+P V+YND+GG  +Q++++RE +ELP+ HPE F K+GI+PP+
Sbjct:   84 RFVVRIAPWIERENLKPGARVALDQRTMAIVELLPSEKDPSVLGFEVIERPTVSYNDIGGLDKQLQELREAIELPLKHPELFEKVGIEPPK 174          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PSMR_THEGJ (Proteasome-activating nucleotidase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pan PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.176e-15
Identity = 46/140 (32.86%), Postives = 75/140 (53.57%), Query Frame = 1
Query:  286 LVSDKQMMQEEQPLQVARCTKIISPNS---------EDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            L +DK+ ++ E        +++  P +         +D + ++      +FVV +   +    ++ G RV +D+    I   LP + DPSV    V EKP VTY D+GG + Q+ ++RE VELP+ HPE F K+GI+PP+
Sbjct:   34 LEADKERLERELSRLRTEMSRLRQPPAFAGTVIEVLDDDRAIVQNYNGPRFVVRIAPWIERDKLKPGSRVALDQRTMAIVELLPTEKDPSVLGFEVIEKPRVTYQDIGGLERQLAELREAVELPLKHPELFEKVGIEPPK 173          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PSMR_METMP (Proteasome-activating nucleotidase OS=Methanococcus maripaludis GN=pan PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.176e-15
Identity = 53/179 (29.61%), Postives = 89/179 (49.72%), Query Frame = 1
Query:  169 YSTSIKKAEKEIKDMAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIISP---------NSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            YST I+K + ++K+  +K   +  ++     L   ++ D+  +   +++E  +      K+  P            + K V+       F+V L   V P DI  G RV +++    I   LP + D     M +EEKPD+++ D+GG   QI  ++EVVELP+ +PE F K+GI PP+
Sbjct:    7 YSTDIEKNKMDLKEFKEKTQ-IAELESKVLRLELKNK-DINRENVQIKKENEILKRELDKLRIPPLILGTILDKVNERKAVVKSSTGPNFLVNLSQFVDPEDIVPGARVCLNQQTLAIVEVLPKEKDYRAMAMEIEEKPDISFEDIGGLNNQIRDIKEVVELPLKNPELFEKVGIVPPK 183          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PSMR_METM6 (Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pan PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.176e-15
Identity = 52/179 (29.05%), Postives = 89/179 (49.72%), Query Frame = 1
Query:  169 YSTSIKKAEKEIKDMAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIISP---------NSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            YST ++K + ++K+  +K   +  ++     L   ++ D+  +   +++E  +      K+  P            + K V+       F+V L   V P DI  G RV +++    I   LP + D     M +EEKPD+++ D+GG   QI  ++EVVELP+ +PE F K+GI PP+
Sbjct:    7 YSTDVEKNKMDLKEFKEKTQ-IAELESKVLRLELKNK-DISRENVQIKKENEILKRELDKLRIPPLILGTILDRVNERKAVVKSSTGPNFLVNLSQFVDPEDIVPGARVCLNQQTLAIVEVLPKEKDYRAMAMEIEEKPDISFEDIGGLNNQIRDIKEVVELPLKNPELFEKVGIVPPK 183          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PRS8_ENCCU (26S protease regulatory subunit 8 homolog OS=Encephalitozoon cuniculi GN=RPT6 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.176e-15
Identity = 39/91 (42.86%), Postives = 61/91 (67.03%), Query Frame = 1
Query:  406 KFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            K++V +   V+  +++ G+RV +  + Y +   LP K+DP V++M VE+ PD TY  +GG  EQI+++REV+ELP+ HPE F  LGI  P+
Sbjct:  141 KYLVKVEPGVNYDELKAGVRVALRSDSYDVHRILPTKVDPLVSLMMVEKVPDSTYQMIGGLDEQIKEIREVIELPIKHPELFENLGIAQPK 231          
The following BLAST results are available for this feature:
BLAST of FC920672 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 109
Match NameE-valueIdentityDescription
PRS8_BOVIN9.769e-1633.5926S protease regulatory subunit 8 OS=Bos taurus GN... [more]
PSMR_METM71.276e-1529.61Proteasome-activating nucleotidase OS=Methanococcu... [more]
PSMR_METVS1.666e-1529.61Proteasome-activating nucleotidase OS=Methanococcu... [more]
PSMR_METM51.666e-1529.61Proteasome-activating nucleotidase OS=Methanococcu... [more]
PRS10_SCHPO1.666e-1534.62Probable 26S protease subunit rpt4 OS=Schizosaccha... [more]
PSMR_THEON2.176e-1541.76Proteasome-activating nucleotidase OS=Thermococcus... [more]
PSMR_THEGJ2.176e-1532.86Proteasome-activating nucleotidase OS=Thermococcus... [more]
PSMR_METMP2.176e-1529.61Proteasome-activating nucleotidase OS=Methanococcu... [more]
PSMR_METM62.176e-1529.05Proteasome-activating nucleotidase OS=Methanococcu... [more]
PRS8_ENCCU2.176e-1542.8626S protease regulatory subunit 8 homolog OS=Encep... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011E08EF RVDevelop1 Citrus clementina cDNA clone C32011E08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920672 ID=FC920672|Name=FC920672|organism=Citrus clementina|type=EST|length=748bp
GGCACTTTTATTTCTCCGCAAGCCATCTTAAATCTTCAGTCTTCCAAGCT
AGCAAAGGAAAGCAAAGCCATGGCACCGGAGCCGGAAGATGAGATCAAGG
ACGAGAAAAACCCTAGGCCTCTCGATGAAGACGATATCGCTCTTCTCAAA
ACCTATGGTTTAGGACCTTATTCTACTAGCATTAAGAAAGCGGAGAAAGA
AATAAAGGATATGGCCAAGAAGGTCAATGACCTGTGTGGTATCAAGGAGT
CTGATACGGGATTAGCTGCACCTAGCCAGTGGGATCTTGTGTCGGATAAG
CAGATGATGCAAGAGGAACAGCCGCTTCAGGTAGCAAGATGCACCAAGAT
AATCAGTCCAAACTCTGAAGATGCCAAATATGTTATAAATGTTAAGCAGA
TTGCAAAGTTTGTTGTTGGGCTTGGTGATAAAGTTTCCCCAACGGATATA
GAAGAGGGCATGCGTGTGGGGGTTGACAGAAATAAATATCAGATTCAAAT
TCCCTTGCCTCCAAAAATTGATCCAAGTGTGACCATGATGACCGTGGAAG
AGAAGCCAGATGTTACATATAATGATGTTGGCGGATGCAAGGAGCAGATT
GAAAAGATGCGAGAAGTTGTTGAGCTACCTATGCTTCATCCTGAGAAATT
TGTAAAGCTTGGAATTGATCCTCCAAGGGTGTTCTATGCTATGGTCCTCT
GGCACTGGTAAACATTTATAGCAGAGCTGTAGCTACAGAACCGATGCT
back to top