FC920674

Overview
NameFC920674
Unique NameFC920674
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length676
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig108 contig Ccv1_Contig108:371..1046. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB21_SINAL (Chlorophyll a-b binding protein 1, chloroplastic OS=Sinapis alba GN=CAB1 PE=3 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.299e-98
Identity = 175/209 (83.73%), Postives = 187/209 (89.47%), Query Frame = 3
Query:   54 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MA STMALSS +F GKAV L+P  +E+   GR++MRKT   +  SGSPWYG DRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AG GPLGE  D LYPGGSFDPLGLA DP AFAE
Sbjct:    1 MAASTMALSSPAFAGKAVKLSPGASEVFGTGRVTMRKTVKPTGPSGSPWYGSDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGEGPLGEAEDLLYPGGSFDPLGLATDPEAFAE 209          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB21_MAIZE (Chlorophyll a-b binding protein 1, chloroplastic OS=Zea mays GN=CAB1 PE=3 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 4.937e-98
Identity = 177/210 (84.29%), Postives = 185/210 (88.10%), Query Frame = 3
Query:   54 MATSTMALSSS-FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MA STMA+SS+   G  + +   G      GRI+MRKT  K    +SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDP AFAE
Sbjct:    1 MAASTMAISSTAMAGTPIKVGSFGE-----GRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAE 205          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB22_HORVU (Chlorophyll a-b binding protein 2, chloroplastic OS=Hordeum vulgare GN=CAB2 PE=3 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 8.421e-98
Identity = 175/208 (84.13%), Postives = 183/208 (87.98%), Query Frame = 3
Query:   54 MATSTMALSSS-FVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MA +TMALSSS F GKAV    S +E+    R+SMRKT +     GSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFK G+QIFSEGGL YLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLADD  AFAE
Sbjct:    1 MAAATMALSSSTFAGKAVKNLSSSSEVQGDARVSMRKTAATK-KVGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLGALGCVFPELLARNGVKFGEAVWFKKGSQIFSEGGLQYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDAEAFAE 207          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB21_WHEAT (Chlorophyll a-b binding protein, chloroplastic OS=Triticum aestivum GN=WHAB1.6 PE=3 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 5.458e-97
Identity = 174/210 (82.86%), Postives = 187/210 (89.05%), Query Frame = 3
Query:   54 MATSTMALSSS-FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MA +TM+LSSS F GKAV   PS + L    R++MRKT +K+  VSS SPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEA WFKAG+QIFS+GGLDYLGNPSL+HAQS+LAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+ P AFAE
Sbjct:    1 MAATTMSLSSSSFAGKAVKNLPS-SALIGDARVNMRKTAAKAKQVSSSSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAGWFKAGSQIFSDGGLDYLGNPSLVHAQSLLAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYPGGSFDPLGLAERPQAFAE 209          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB28_PEA (Chlorophyll a-b binding protein 8, chloroplastic OS=Pisum sativum GN=CAB8 PE=1 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 1.216e-96
Identity = 177/212 (83.49%), Postives = 186/212 (87.74%), Query Frame = 3
Query:   54 MATSTMALSS-SFVGKAVNLA--PSGNELSNGGRISMRK--TGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MA S+MALSS +  GK V  +  PS  EL  G R +MRK  T  K  SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDP AFAE
Sbjct:    1 MAASSMALSSPTLTGKPVETSANPSSQELG-GARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAE 211          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB21_ARATH (Chlorophyll a-b binding protein 165/180, chloroplastic OS=Arabidopsis thaliana GN=LHCP-A PE=1 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 1.216e-96
Identity = 174/210 (82.86%), Postives = 188/210 (89.52%), Query Frame = 3
Query:   54 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVS-SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MA STMALSS +F GKAVNL+P+ +E+   GR++MRKT +K    SGSPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFS+GGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AG GPLGE  D LYPGGSFDPLGLA DP AFAE
Sbjct:    1 MAASTMALSSPAFAGKAVNLSPAASEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAE 210          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB22_PEA (Chlorophyll a-b binding protein AB80, chloroplastic OS=Pisum sativum GN=AB80 PE=1 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 1.588e-96
Identity = 174/209 (83.25%), Postives = 185/209 (88.52%), Query Frame = 3
Query:   57 ATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRK--TGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            ++S+MALSS +  GK + L PS  EL    R +MRK  T  K  SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDP AFAE
Sbjct:    5 SSSSMALSSPTLAGKQLKLNPSSQELG-AARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAE 212          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB21_SOYBN (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Glycine max PE=2 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 2.709e-96
Identity = 166/178 (93.26%), Postives = 171/178 (96.07%), Query Frame = 3
Query:  141 GRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            GR+SMRKT SK+VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEA WFKAG+QIFSEGGLDYLGN SLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGEVTDP+YPGGSFDPL LADDP AFAE
Sbjct:   11 GRVSMRKTASKTVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEASWFKAGSQIFSEGGLDYLGNQSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLALADDPEAFAE 188          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB22_ARATH (Chlorophyll a-b binding protein 2, chloroplastic OS=Arabidopsis thaliana GN=CAB2A PE=1 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 6.035e-96
Identity = 173/210 (82.38%), Postives = 187/210 (89.05%), Query Frame = 3
Query:   54 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVS-SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MA STMALSS +F GKAV L+P+ +E+   GR++MRKT +K    SGSPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFS+GGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AG GPLGE  D LYPGGSFDPLGLA DP AFAE
Sbjct:    1 MAASTMALSSPAFAGKAVKLSPAASEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAE 210          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB21_ORYSJ (Chlorophyll a-b binding protein 1, chloroplastic OS=Oryza sativa subsp. japonica GN=CAB1R PE=2 SV=2)

HSP 1 Score: 349.362 bits (895), Expect = 1.029e-95
Identity = 176/211 (83.41%), Postives = 185/211 (87.68%), Query Frame = 3
Query:   54 MATSTMALSSSFVGKAVNLAPS-GNELSNGGRISMRKTGSK---SVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            MA +TMALSS  + +A   APS  + L    RI+MRKT +K   + SSGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGEV DPLYPGG+FDPLGLADDP AFAE
Sbjct:    1 MAAATMALSSPVMARA---APSTSSALFGEARITMRKTAAKPKPAASSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGAFDPLGLADDPEAFAE 208          
The following BLAST results are available for this feature:
BLAST of FC920674 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
CB21_SINAL1.299e-9883.73Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB21_MAIZE4.937e-9884.29Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB22_HORVU8.421e-9884.13Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB21_WHEAT5.458e-9782.86Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB28_PEA1.216e-9683.49Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB21_ARATH1.216e-9682.86Chlorophyll a-b binding protein 165/180, chloropla... [more]
CB22_PEA1.588e-9683.25Chlorophyll a-b binding protein AB80, chloroplasti... [more]
CB21_SOYBN2.709e-9693.26Chlorophyll a-b binding protein, chloroplastic (Fr... [more]
CB22_ARATH6.035e-9682.38Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB21_ORYSJ1.029e-9583.41Chlorophyll a-b binding protein 1, chloroplastic O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011E11EF RVDevelop1 Citrus clementina cDNA clone C32011E11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920674 ID=FC920674|Name=FC920674|organism=Citrus clementina|type=EST|length=676bp
GACCTCTCAACACTCGAACACTCGAGCTCACCAACAACTCTGATCATTGC
AAAATGGCAACCTCAACAATGGCTCTCTCCTCATCATTCGTCGGCAAGGC
TGTGAACCTCGCCCCTTCAGGCAATGAGCTGAGCAATGGTGGCCGCATCT
CCATGCGTAAAACCGGGAGCAAGTCTGTTTCTTCAGGCAGCCCGTGGTAC
GGCCCGGACAGAGTCAAGTACTTGGGCCCATTCTCTGGCGAGCCCCCAAG
CTACTTGACCGGTGAGTTCCCTGGCGACTACGGTTGGGACACAGCCGGGC
TTTCAGCTGACCCAGAAACCTTTGCCAAGAACCGTGAACTCGAAGTCATC
CACTGCAGATGGGCCATGTTGGGAGCTCTTGGATGCGTCTTCCCGGAGCT
CTTGGCCCGCAACGGAGTCAAGTTCGGTGAGGCCGTGTGGTTCAAGGCGG
GAGCTCAGATCTTCAGCGAGGGCGGGCTTGACTACTTGGGAAACCCAAGC
TTGATCCACGCCCAGAGCATCTTGGCCATCTGGGCTTGCCAGGTGGTCTT
GATGGGAGCTGTTGAGGGTTACAGAATTGCTGGAGGGCCGCTCGGTGAAG
TGACCGACCCATTGTACCCAGGTGGCAGCTTTGATCCATTGGGTTTGGCT
GATGACCCCGGAGCTTTTGCTGAGCT
back to top