FC920674

Overview
NameFC920674
Unique NameFC920674
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length676
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig108 contig Ccv1_Contig108:371..1046. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: CB21_EUGGR (Chlorophyll a-b binding protein of LHCII type 1 (Fragment) OS=Euglena gracilis PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.987e-14
Identity = 42/62 (67.74%), Postives = 46/62 (74.19%), Query Frame = 3
Query:  498 SLIHAQSILAIWACQVVLMGAVEGYRI---AGGPLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            +LIHA+S+LAI A QV+LMGAVEGYR    A G  GE  D LYPGG FDPLGLADDP  F E
Sbjct:    4 ALIHAKSLLAILATQVLLMGAVEGYRAGNTAPGQFGEDLDRLYPGGPFDPLGLADDPDTFPE 65          
BLAST of FC920674 vs. ExPASy Swiss-Prot
Match: LH18_EUGGR (Light-harvesting complex I LH38 proteins (Fragment) OS=Euglena gracilis PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.595e-14
Identity = 58/141 (41.13%), Postives = 74/141 (52.48%), Query Frame = 3
Query:  243 PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPL---GEVTDPLYPGGSFDPLGLADD 656
            PP YLTGE  GD G+D AGL+ADP TF + +  EV HCR +ML  +GC+ PELL       G   WF    QI+ +  +D+          +  A+ A QVV    +E +R  GG L    E  D  YPG  FDPL L  +
Sbjct:  380 PPRYLTGEAYGDKGFDPAGLAADPVTFERMQVAEVFHCRLSMLALVGCLVPELL-------GNGAWF----QIWDK--VDF----------NRFAVVALQVV--APLEYWRGNGGFLWNDEETVDQSYPG--FDPLNLTTE 493          

HSP 2 Score: 77.7962 bits (190), Expect = 5.781e-14
Identity = 54/150 (36.00%), Postives = 72/150 (48.00%), Query Frame = 3
Query:  234 SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGG---PLGEVTDPLYPGGSFDPLGLADDPGAFAE 674
            + EPP+ LTGE+P D G+D   L+ADP+ +A+ R  EV H R AML  +GC+ PELL       G+  WF+AG  +                    L +    + +    E +R  GG     GE+ D  YPG  FDPL L  D    AE
Sbjct:  193 NAEPPALLTGEYPADRGFDPLNLAADPDVYARMRVAEVFHGRLAMLCTVGCIVPELL-------GKGAWFEAGDSVDG------------------LKLGFITMAIAAPTEYWRGQGGFNWQKGEL-DRSYPG--FDPLNLTTDYTRAAE 314          

HSP 3 Score: 68.1662 bits (165), Expect = 4.580e-11
Identity = 49/140 (35.00%), Postives = 69/140 (49.29%), Query Frame = 3
Query:  246 PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEG-YRIAGGPLGEVTDP--LYPGGSFDPLGLADD 656
            PS+L GE+ GD G+D AGL+ADP+TF + R  EV H R AML  +G + P+ L       G+ +W++A                          I   +V +  A  G + +A G + E +DP  +YPG  FDPL L  D
Sbjct:   12 PSWLNGEYYGDRGFDPAGLAADPDTFERMRIAEVYHGRLAMLAVVGALVPDYL-------GKGIWYEAAQN---------------------AGIGLKEVAIFTAAYGVFEVARG-VKENSDPTTIYPG--FDPLNLTTD 120          
The following BLAST results are available for this feature:
BLAST of FC920674 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
CB21_EUGGR1.987e-1467.74Chlorophyll a-b binding protein of LHCII type 1 (F... [more]
LH18_EUGGR2.595e-1441.13Light-harvesting complex I LH38 proteins (Fragment... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011E11EF RVDevelop1 Citrus clementina cDNA clone C32011E11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920674 ID=FC920674|Name=FC920674|organism=Citrus clementina|type=EST|length=676bp
GACCTCTCAACACTCGAACACTCGAGCTCACCAACAACTCTGATCATTGC
AAAATGGCAACCTCAACAATGGCTCTCTCCTCATCATTCGTCGGCAAGGC
TGTGAACCTCGCCCCTTCAGGCAATGAGCTGAGCAATGGTGGCCGCATCT
CCATGCGTAAAACCGGGAGCAAGTCTGTTTCTTCAGGCAGCCCGTGGTAC
GGCCCGGACAGAGTCAAGTACTTGGGCCCATTCTCTGGCGAGCCCCCAAG
CTACTTGACCGGTGAGTTCCCTGGCGACTACGGTTGGGACACAGCCGGGC
TTTCAGCTGACCCAGAAACCTTTGCCAAGAACCGTGAACTCGAAGTCATC
CACTGCAGATGGGCCATGTTGGGAGCTCTTGGATGCGTCTTCCCGGAGCT
CTTGGCCCGCAACGGAGTCAAGTTCGGTGAGGCCGTGTGGTTCAAGGCGG
GAGCTCAGATCTTCAGCGAGGGCGGGCTTGACTACTTGGGAAACCCAAGC
TTGATCCACGCCCAGAGCATCTTGGCCATCTGGGCTTGCCAGGTGGTCTT
GATGGGAGCTGTTGAGGGTTACAGAATTGCTGGAGGGCCGCTCGGTGAAG
TGACCGACCCATTGTACCCAGGTGGCAGCTTTGATCCATTGGGTTTGGCT
GATGACCCCGGAGCTTTTGCTGAGCT
back to top