FC920694

Overview
NameFC920694
Unique NameFC920694
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length649
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: BARS_ARATH (Alpha-barbatene synthase OS=Arabidopsis thaliana GN=BS PE=1 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 3.880e-28
Identity = 76/187 (40.64%), Postives = 106/187 (56.68%), Query Frame = 2
Query:  104 KVIQNAGKDSTRGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAANKTSH-----TLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLESVA 649
            + + N   +S       P S WGD F +++    + D    +   LK ++R  +  ++ T       T+  I  +  LG+SYHFE EI+E L   H   +  DL  +EN  L+ IS  FR+FR  GY +S+DVF  F G DGKF  SL +DV+GMLSFYEA H     ++ILDEAL+FT +HLES+A
Sbjct:    2 EALGNFDYESYTNFTKLPSSQWGDQFLKFSIADSDFDVLEREIEVLKPKVRENIFVSSSTDKDAMKKTILSIHFLDSLGLSYHFEKEIEESL--KHAFEKIEDLIADENK-LHTISTIFRVFRTYGYYMSSDVFKIFKGDDGKFKESLIEDVKGMLSFYEAVHFGTTTDHILDEALSFTLNHLESLA 185          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: HUMS_ARATH (Alpha-humulene/(-)-(E)-beta-caryophyllene synthase OS=Arabidopsis thaliana GN=TPS21 PE=2 SV=2)

HSP 1 Score: 124.405 bits (311), Expect = 5.067e-28
Identity = 68/177 (38.42%), Postives = 97/177 (54.80%), Query Frame = 2
Query:  122 GKDSTRGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAANKTS-HTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLESVA 649
            G +  R  A+FP +IW D    ++     T+    KH  LK+ ++    ++       ++ IDA+ RLGVSYHFE +I E L K         +   E   LY + + F++FRQ G+++SADVF  F   +GKF   L  D  GMLS YEA     H E+I+DEALAF+ SHLE ++
Sbjct:    2 GSEVNRPLADFPANIWEDPLTSFSKSDLGTETFKEKHSTLKEAVKEAFMSSKANPIENIKFIDALCRLGVSYHFEKDIVEQLDKSFDCLDFPQMVRQEGCDLYTVGIIFQVFRQFGFKLSADVFEKFKDENGKFKGHLVTDAYGMLSLYEAAQWGTHGEDIIDEALAFSRSHLEEIS 178          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: TPS2_CANSA ((+)-alpha-pinene synthase, chloroplastic OS=Cannabis sativa PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.129e-26
Identity = 70/186 (37.63%), Postives = 103/186 (55.38%), Query Frame = 2
Query:   86 VSASPAKVIQNAGKDSTRGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAK-DVRGMLSFYEATHLRVHEENILDEALAFTSSHLE 640
            +  S AK   +      R SAN+ P IW   F Q      + +    +  +LK+E+++ML     +   LELID +QRLG+SYHFENEI  IL    + + +     N    LY  +L+FRL R+ GY I  ++FN F    GKF AS+   D++G+L+ YEA+    + ENIL+EA  FT+ +L+
Sbjct:   54 IQCSLAKSPSSDTSTIVRRSANYDPPIWSFDFIQSLPCKYKGEPYTSRSNKLKEEVKKMLVGMENSLVQLELIDTLQRLGISYHFENEIISIL---KEYFTNISTNKNPKYDLYATALEFRLLREYGYAIPQEIFNDFKDETGKFKASIKNDDIKGVLALYEASFYVKNGENILEEARVFTTEYLK 236          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: GBIS2_ARATH ((Z)-gamma-bisabolene synthase 2 OS=Arabidopsis thaliana GN=TPS13 PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 8.090e-26
Identity = 71/165 (43.03%), Postives = 100/165 (60.61%), Query Frame = 2
Query:  161 SIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRML--KAANKTS-HTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLESV 646
            S W D+F     D  E D    +   +K E+R++L  K  ++TS   + LI ++  LG+++HFENEI +IL    +  R  D+  +END L  IS+ FR+FR  G+ + + VF  F G DGKF  SL +D +G+LS YEA HL    + ILDEAL FTSSHL+S+
Sbjct:   20 SQWTDYFLSVPIDDSELDAITREIDIIKPEVRKLLSSKGDDETSKRKVLLIQSLLSLGLAFHFENEIKDILEDAFR--RIDDITGDEND-LSTISIMFRVFRTYGHNLPSSVFKRFTGDDGKFERSLTEDAKGILSLYEAAHLGTTTDYILDEALEFTSSHLKSL 181          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: RLC1_CITLI ((R)-limonene synthase 1 OS=Citrus limon PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.354e-25
Identity = 67/171 (39.18%), Postives = 102/171 (59.65%), Query Frame = 2
Query:  137 RGSANFPPSIWGDHFFQYTCDSQETDDQNVKHL-ELKKEIRRMLKAANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLESV 646
            R SAN+ PSIW DH F  + +S  TD+   +   EL+ +++  +K   +    LELID +QRLG+++ FE EI  IL  ++   +D +      + LY  SL+FRL RQ+GY +S +VFN F    G F   +  D +G+LS +EA++  +  E+I++EA  FTS HL+ V
Sbjct:   53 RRSANYQPSIW-DHDFLQSLNSNYTDEAYKRRAEELRGKVKIAIKDVIEPLDQLELIDNLQRLGLAHRFETEIRNILNNIYNNNKDYNW---RKENLYATSLEFRLLRQHGYPVSQEVFNGFKDDQGGF---ICDDFKGILSLHEASYYSLEGESIMEEAWQFTSKHLKEV 216          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: TPS1_CANSA ((-)-limonene synthase, chloroplastic OS=Cannabis sativa GN=TPS1 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.993e-24
Identity = 70/183 (38.25%), Postives = 100/183 (54.64%), Query Frame = 2
Query:   95 SPAKVIQNAGKDSTRGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMG-SDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLE 640
            +P+  I N   +S R SAN+ P IW   F Q      + +    +  +L+K+++RML     +   LELID IQRLG+SY FENEI  IL +      D     N N  LY  +LQFRL RQ G+ +  ++FN F     G+F A+++ D+ G L  YEA+      E+IL+EA  FT+  L+
Sbjct:   66 NPSSTITN---NSDRRSANYGPPIWSFDFVQSLPIQYKGESYTSRLNKLEKDVKRMLIGVENSLAQLELIDTIQRLGISYRFENEIISILKEKFTNNND---NPNPNYDLYATALQFRLLRQYGFEVPQEIFNNFKNHKTGEFKANISNDIMGALGLYEASFHGKKGESILEEARIFTTKCLK 242          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: GBIS1_ARATH ((Z)-gamma-bisabolene synthase 1 OS=Arabidopsis thaliana GN=TPS12 PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 7.572e-24
Identity = 64/163 (39.26%), Postives = 88/163 (53.99%), Query Frame = 2
Query:  167 WGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAANK---TSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLESV 646
            W D+F     D  E D    +   LK E+  +L +      +   + LI  +  LG+++HFENEI  IL      +R  D    +   L  IS+ FR+FR  G+ + + VF  F G DGKF  SL +D +G+LS YEA HL    + ILDEAL FTSSHL+S+
Sbjct:   22 WTDYFLSVPIDESELDVITREIDILKPEVMELLSSQGDDETSKRKVLLIQLLLSLGLAFHFENEIKNIL---EHAFRKIDDITGDEKDLSTISIMFRVFRTYGHNLPSSVFKRFTGDDGKFQQSLTEDAKGILSLYEAAHLGTTTDYILDEALKFTSSHLKSL 181          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: MYRS1_ARATH (Myrcene/ocimene synthase 1, chloroplastic OS=Arabidopsis thaliana GN=TPS10 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.865e-22
Identity = 64/150 (42.67%), Postives = 92/150 (61.33%), Query Frame = 2
Query:  137 RGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKE-IRRMLKAANKTS-HTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHL 580
            R SAN+ PS W DH    + +++   D+ V+  +L KE +R+ML    KT    LE ID +Q+LGVSYHFE EID IL   +K     D  + +   L+  +L+FRLFRQ+G+ +S DVF+ FM + GKF      D+ G++S YEA++L
Sbjct:   46 RRSANYQPSRW-DHHHLLSVENKFAKDKRVRERDLLKEKVRKMLNDEQKTYLDQLEFIDDLQKLGVSYHFEAEIDNILTSSYKK----DRTNIQESDLHATALEFRLFRQHGFNVSEDVFDVFMENCGKFDRD---DIYGLISLYEASYL 187          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: OCIS_ARATH ((E)-beta-ocimene synthase, chloroplastic OS=Arabidopsis thaliana GN=TPS03 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.062e-21
Identity = 65/172 (37.79%), Postives = 98/172 (56.98%), Query Frame = 2
Query:  134 TRGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLEL-KKEIRRMLKAANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMH-KTYR--DCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHL 637
            +R SAN+ PS+W  H +  +  +    + NV+ + L K+E+ +ML         LELID +QRLGVSYHFE EI + L  +H K  R     +  N    LY  +L+FRL RQ+G+ I+ DVF+  +G D        KD++G+LS YEA++L    +  L E++ +T+  L
Sbjct:   25 SRRSANYQPSLW-QHEYLLSLGNTYVKEDNVERVTLLKQEVSKMLNETEGLLEQLELIDTLQRLGVSYHFEQEIKKTLTNVHVKNVRAHKNRIDRNRWGDLYATALEFRLLRQHGFSIAQDVFDGNIGVDLD-----DKDIKGILSLYEASYLSTRIDTKLKESIYYTTKRL 190          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: BPPS_SALOF ((+)-bornyl diphosphate synthase, chloroplastic OS=Salvia officinalis PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.693e-21
Identity = 65/173 (37.57%), Postives = 96/173 (55.49%), Query Frame = 2
Query:  137 RGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKE----IRRMLKAANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDG-KFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLE 640
            R S N+ P++W  ++ Q    S  T     +HL+ K E    +R +LK   +    LELI  ++ LG+S  F++EI EILG ++  ++     + E   LY+ +L FRL RQ+G+ IS DVFN F    G  F ASLA+D +GML  YEA+ L    E+ L+ A  F +  L+
Sbjct:   55 RRSGNYQPALWDSNYIQ----SLNTPYTEERHLDRKAELIVQVRILLKEKMEPVQQLELIHDLKYLGLSDFFQDEIKEILGVIYNEHKCFHNNEVEKMDLYFTALGFRLLRQHGFNISQDVFNCFKNEKGIDFKASLAQDTKGMLQLYEASFLLRKGEDTLELAREFATKCLQ 223          
The following BLAST results are available for this feature:
BLAST of FC920694 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
BARS_ARATH3.880e-2840.64Alpha-barbatene synthase OS=Arabidopsis thaliana G... [more]
HUMS_ARATH5.067e-2838.42Alpha-humulene/(-)-(E)-beta-caryophyllene synthase... [more]
TPS2_CANSA2.129e-2637.63(+)-alpha-pinene synthase, chloroplastic OS=Cannab... [more]
GBIS2_ARATH8.090e-2643.03(Z)-gamma-bisabolene synthase 2 OS=Arabidopsis tha... [more]
RLC1_CITLI2.354e-2539.18(R)-limonene synthase 1 OS=Citrus limon PE=2 SV=1[more]
TPS1_CANSA1.993e-2438.25(-)-limonene synthase, chloroplastic OS=Cannabis s... [more]
GBIS1_ARATH7.572e-2439.26(Z)-gamma-bisabolene synthase 1 OS=Arabidopsis tha... [more]
MYRS1_ARATH1.865e-2242.67Myrcene/ocimene synthase 1, chloroplastic OS=Arabi... [more]
OCIS_ARATH2.062e-2137.79(E)-beta-ocimene synthase, chloroplastic OS=Arabid... [more]
BPPS_SALOF2.693e-2137.57(+)-bornyl diphosphate synthase, chloroplastic OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011H02EF RVDevelop1 Citrus clementina cDNA clone C32011H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920694 ID=FC920694|Name=FC920694|organism=Citrus clementina|type=EST|length=649bp
GGAATCAGCAAAGCTTTGGCTACCTTTTTTTTTCTCAAGACTCAATAGCC
TTCAGAAGTAATAGAAATTAAGTATGTCTTTAGAAGTTTCAGCCTCTCCT
GCTAAGGTCATCCAAAATGCTGGAAAAGATTCTACTCGTGGTTCTGCAAA
TTTTCCTCCAAGCATTTGGGGAGATCATTTCTTTCAATATACTTGTGACT
CCCAGGAAACTGATGATCAAAATGTAAAGCATCTAGAGCTGAAGAAAGAA
ATTAGAAGAATGCTGAAAGCTGCTAACAAGACTTCACATACACTTGAATT
GATAGATGCAATTCAGCGGTTAGGAGTGTCGTACCATTTTGAAAATGAGA
TTGATGAAATCTTGGGAAAGATGCACAAGACTTATCGAGACTGTGATCTT
TGTGATAATGAAAATGATGGGCTCTATTATATCTCTCTTCAGTTTCGATT
GTTCAGACAAAATGGCTATAGAATTTCCGCTGATGTTTTCAATGCGTTCA
TGGGAAGCGATGGGAAATTTATGGCATCTCTTGCAAAAGATGTTCGAGGA
ATGTTAAGCTTCTATGAAGCTACACATCTCAGGGTTCATGAAGAAAATAT
ACTAGATGAAGCGCTTGCTTTCACCTCTAGTCACCTTGAGTCAGTGGCA
back to top