FC920694

Overview
NameFC920694
Unique NameFC920694
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length649
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: SSS_SALOF ((+)-sabinene synthase, chloroplastic OS=Salvia officinalis PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.337e-20
Identity = 60/177 (33.90%), Postives = 95/177 (53.67%), Query Frame = 2
Query:  110 IQNAGKDSTRGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAF-MGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHL 637
            +Q       R S ++ PS+W  ++ Q      +      +  EL  ++R +LK   +    LELID +Q LG+SY F++EI +IL  +H   R        N+ LY+ +L FR+ RQ+G+ +S DVF+ F +     F A+LA+D +GML  YEA+ L    E+ L+ A  F++  L
Sbjct:   43 LQQEKPHQIRRSGDYQPSLWDFNYIQSLNTPYKEQRHFNRQAELIMQVRMLLKVKMEAIQQLELIDDLQYLGLSYFFQDEIKQILSSIHNEPRYF-----HNNDLYFTALGFRILRQHGFNVSEDVFDCFKIEKCSDFNANLAQDTKGMLQLYEASFLLREGEDTLELARRFSTRSL 214          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: TPS02_ARATH (Probable terpenoid synthase 2, chloroplastic OS=Arabidopsis thaliana GN=TPS02 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.299e-19
Identity = 49/138 (35.51%), Postives = 83/138 (60.14%), Query Frame = 2
Query:  233 LELKKEIRRMLKAANKT---SHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHL 637
            L+ K  +R+ ++ A K       LE+ID++QRLG+SYH+++EI +IL K+H  + + +    E   L+  SL+F L RQ+G+ +S D F+ F+   G+F  +L  D++G+LS YEA++  +  E  L E   + +  L
Sbjct:   87 LKYKDGMRKEVETAEKAILFKEELEMIDSLQRLGISYHYKHEIHDILRKIHDQHGEIE---RETQDLHATSLEFILLRQHGFDVSQDAFDVFISETGEFRKTLHSDIKGLLSLYEASYFSMDSEFKLKETRIYANKRL 221          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: MYRS2_ARATH (Myrcene/ocimene synthase 2, chloroplastic OS=Arabidopsis thaliana GN=TPS24 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.251e-18
Identity = 62/185 (33.51%), Postives = 108/185 (58.38%), Query Frame = 2
Query:   86 VSASPAKVIQNAGK-DSTRGSANFPPSIWGDHFFQYTCDSQETDDQNV--KHLELKKEIRRMLKAANKTSHT--LELIDAIQRLGVSYHFENEIDEILGKMH-KTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAK--DVRGMLSFYEATHLRVHEENILDEAL 616
            +S S  K + +A   D  R S N+ PS W DH +  + +++  +++ V  +H+ LKK++++ML+     S    LELID +Q+LGVSYHFE EI+ IL   H +  ++   CD E D L+  +L+FRL RQ+G+ +S D+F+  +    K  ++  K  ++  +++ YEA++L    +  L + +
Sbjct:   29 ISKSMTKTMPDANPLDLRRRSGNYQPSSW-DHSYLLSIENKYVNEKEVITRHV-LKKKVKKMLEEVETKSRLEKLELIDDLQKLGVSYHFEQEINNILTNFHLENGKNIWKCDKEED-LHATALEFRLLRQHGFGVSEDIFDVII---DKIESNTFKSDNITSIITLYEASYLSTKSDTKLHKVI 207          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: CINS_ARATH (1,8-cineole synthase, chloroplastic OS=Arabidopsis thaliana GN=TPS27 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.640e-18
Identity = 55/163 (33.74%), Postives = 92/163 (56.44%), Query Frame = 2
Query:  134 TRGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAANKTS-HTLELIDAIQRLGVSYHFENEIDEILGKMH-KTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEAL 616
            +R S N+ PS W   +     +   ++ + +    LKK+++ ML    K+    LELID +Q+LGVSYHFE EI++ L  +H K  R+C  CD E D L+  SL+FRL RQ+G+ +S ++F+  +    +       ++ G++S YEA++L    +  L + +
Sbjct:   46 SRRSGNYQPSPWNHCYLLSIENKYASETEVITRDVLKKKVKSMLDDEKKSRLEQLELIDDLQKLGVSYHFEIEINDTLTDLHLKMGRNCWKCDKEED-LHATSLEFRLLRQHGFDVSENIFDVII-DQIESNTFKTNNINGIISLYEASYLSTKSDTKLHKVI 206          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: SCS_SALOF (1,8-cineole synthase, chloroplastic OS=Salvia officinalis PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 9.912e-16
Identity = 52/168 (30.95%), Postives = 82/168 (48.81%), Query Frame = 2
Query:  137 RGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDG-KFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHL 637
            R +  + P++W     Q      + +   ++   +  ++  +L+    +   LELID ++RLG+S HF+ EI EIL   + T  + D  D     LY  +L+F+L RQ  + +S +VF+ F    G  F  SL  D RG+L  YEA+ L    E  L  A  F +  L
Sbjct:   57 RRTGGYQPTLWDFSTIQLFDSEYKEEKHLMRAAGMIAQVNMLLQEEVDSIQRLELIDDLRRLGISCHFDREIVEILNSKYYTNNEIDESD-----LYSTALRFKLLRQYDFSVSQEVFDCFKNDKGTDFKPSLVDDTRGLLQLYEASFLSAQGEETLHLARDFATKFL 219          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: LINS_ARATH (Linalool synthase, chloroplastic OS=Arabidopsis thaliana GN=TPS14 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 7.103e-14
Identity = 47/135 (34.81%), Postives = 69/135 (51.11%), Query Frame = 2
Query:  245 KEIRRMLKA-ANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLESV 646
            K+I+ +L A  +  S  LE+ID IQ LG   HF   I++ L  ++K           N  L+ I+L+FRL RQ G+ +   +F   +   G F   +  DV+G+   +EA+ LRV  E  LD A  FT S L  +
Sbjct:   77 KKIKNILSANVDVPSENLEMIDVIQSLGTDLHFRQGIEQTLHMIYKEGLQF------NGDLHEIALRFRLLRQEGHYVQESIFKNILDKKGGFKDVVKNDVKGLTELFEASELRVEGEETLDGAREFTYSRLNEL 205          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: TPSD3_ABIGR (Pinene synthase, chloroplastic OS=Abies grandis GN=ag3 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.285e-12
Identity = 53/203 (26.11%), Postives = 98/203 (48.28%), Query Frame = 2
Query:   86 VSASPAKVIQNAGKDSTRGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAA-----------NKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDL-CDNEN--DGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMAS----LAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLE 640
            +S S   V+ + G     G  +F  ++W D   Q    + E      +  +L  E++ M  +            N     L ++D+++RLG+  HF++EI   L  ++  + +  + C  E+    L   +L  R  R +GY +S+DVF AF G +G+F  S      +++RG+L+ + A+ +    E I+DEA  F++ +L+
Sbjct:   49 ISMSSTTVVTDDGVRRRMG--DFHSNLWDDDVIQSLPTAYEEKSYLERAEKLIGEVKNMFNSMSLEDGELMSPLNDLIQRLWIVDSLERLGIHRHFKDEIKSALDYVYSYWGENGIGCGRESVVTDLNSTALGLRTLRLHGYPVSSDVFKAFKGQNGQFSCSENIQTDEEIRGVLNLFRASLIAFPGEKIMDEAEIFSTKYLK 249          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: KSA_ARATH (Ent-copalyl diphosphate synthase, chloroplastic OS=Arabidopsis thaliana GN=GA1 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.898e-12
Identity = 43/119 (36.13%), Postives = 67/119 (56.30%), Query Frame = 2
Query:  299 LIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYI---SLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKD---VRGMLSFYEATHLRVHEENILDEALAFTSSHL 637
            ++D +QRLG+S +FE EI E L  +H+ + D  +C      +  I   ++ FRL RQ+GY++SADVF  F   +G+F   + +    V GM + Y A+ L    E IL  A  F+ ++L
Sbjct:  334 IVDRLQRLGISRYFEEEIKECLDYVHRYWTDNGICWARCSHVQDIDDTAMAFRLLRQHGYQVSADVFKNF-EKEGEFFCFVGQSNQAVTGMFNLYRASQLAFPREEILKNAKEFSYNYL 451          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: TPSD1_ABIGR (Alpha-bisabolene synthase OS=Abies grandis GN=ag1 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.649e-12
Identity = 45/121 (37.19%), Postives = 67/121 (55.37%), Query Frame = 2
Query:  293 LELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCD---NENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLA---KDVRGMLSFYEATHLRVHEENILDEALAFTSSHL 637
            L ++D I RLG+  HFE EI E L  +++ + +  +     N    L   +L FRL R + Y +S  +F+ F  ++GKF+ S     KDV  ML+ Y A+ L    ENILDEA +F + +L
Sbjct:  302 LLIVDNIVRLGIYRHFEKEIKEALDYVYRHWNERGIGWGRLNPIADLETTALGFRLLRLHRYNVSPAIFDNFKDANGKFICSTGQFNKDVASMLNLYRASQLAFPGENILDEAKSFATKYL 422          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: TPSD2_ABIGR (Myrcene synthase, chloroplastic OS=Abies grandis GN=ag2 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.481e-11
Identity = 48/185 (25.95%), Postives = 95/185 (51.35%), Query Frame = 2
Query:  137 RGSANFPPSIWGDHFFQY--TCDSQETDDQNVKHL--ELKKEIR-------RMLKAANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDL-CDNEN--DGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAK---DVRGMLSFYEATHLRVHEENILDEALAFTSSHLE 640
            R   ++  +IW D F Q   T   + +  +  + L  E+KK          R++ + N     L ++D+++RLG++ HF+NEI   L  + + + +  + C  ++    L   +L FR  R +GY +S +V  AF   +G+F+ S  +   ++R +L+ Y A+ +    E +++EA  F++ +L+
Sbjct:   64 RRIGDYHSNIWDDDFIQSLSTPYGEPSYQERAERLIVEVKKIFNSMYLDDGRLMSSFNDLMQRLWIVDSVERLGIARHFKNEITSALDYVFRYWEENGIGCGRDSIVTDLNSTALGFRTLRLHGYTVSPEVLKAFQDQNGQFVCSPGQTEGEIRSVLNLYRASLIAFPGEKVMEEAEIFSTRYLK 248          
The following BLAST results are available for this feature:
BLAST of FC920694 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
SSS_SALOF1.337e-2033.90(+)-sabinene synthase, chloroplastic OS=Salvia off... [more]
TPS02_ARATH4.299e-1935.51Probable terpenoid synthase 2, chloroplastic OS=Ar... [more]
MYRS2_ARATH1.251e-1833.51Myrcene/ocimene synthase 2, chloroplastic OS=Arabi... [more]
CINS_ARATH3.640e-1833.741,8-cineole synthase, chloroplastic OS=Arabidopsis... [more]
SCS_SALOF9.912e-1630.951,8-cineole synthase, chloroplastic OS=Salvia offi... [more]
LINS_ARATH7.103e-1434.81Linalool synthase, chloroplastic OS=Arabidopsis th... [more]
TPSD3_ABIGR2.285e-1226.11Pinene synthase, chloroplastic OS=Abies grandis GN... [more]
KSA_ARATH3.898e-1236.13Ent-copalyl diphosphate synthase, chloroplastic OS... [more]
TPSD1_ABIGR6.649e-1237.19Alpha-bisabolene synthase OS=Abies grandis GN=ag1 ... [more]
TPSD2_ABIGR1.481e-1125.95Myrcene synthase, chloroplastic OS=Abies grandis G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011H02EF RVDevelop1 Citrus clementina cDNA clone C32011H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920694 ID=FC920694|Name=FC920694|organism=Citrus clementina|type=EST|length=649bp
GGAATCAGCAAAGCTTTGGCTACCTTTTTTTTTCTCAAGACTCAATAGCC
TTCAGAAGTAATAGAAATTAAGTATGTCTTTAGAAGTTTCAGCCTCTCCT
GCTAAGGTCATCCAAAATGCTGGAAAAGATTCTACTCGTGGTTCTGCAAA
TTTTCCTCCAAGCATTTGGGGAGATCATTTCTTTCAATATACTTGTGACT
CCCAGGAAACTGATGATCAAAATGTAAAGCATCTAGAGCTGAAGAAAGAA
ATTAGAAGAATGCTGAAAGCTGCTAACAAGACTTCACATACACTTGAATT
GATAGATGCAATTCAGCGGTTAGGAGTGTCGTACCATTTTGAAAATGAGA
TTGATGAAATCTTGGGAAAGATGCACAAGACTTATCGAGACTGTGATCTT
TGTGATAATGAAAATGATGGGCTCTATTATATCTCTCTTCAGTTTCGATT
GTTCAGACAAAATGGCTATAGAATTTCCGCTGATGTTTTCAATGCGTTCA
TGGGAAGCGATGGGAAATTTATGGCATCTCTTGCAAAAGATGTTCGAGGA
ATGTTAAGCTTCTATGAAGCTACACATCTCAGGGTTCATGAAGAAAATAT
ACTAGATGAAGCGCTTGCTTTCACCTCTAGTCACCTTGAGTCAGTGGCA
back to top