FC920694

Overview
NameFC920694
Unique NameFC920694
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length649
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: TPSD6_ABIGR (Camphene synthase, chloroplastic OS=Abies grandis GN=ag6 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.526e-11
Identity = 49/189 (25.93%), Postives = 92/189 (48.68%), Query Frame = 2
Query:  119 AGKDST-RGSANFPPSIWGDHFFQYTC-------DSQETDDQNVKHL-ELKKEIRRMLKAANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDL-CDNEN--DGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMAS----LAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHL 637
            A  DS  R   N+  ++W D F Q          D +E  D+ +  + ++    + +    N     L L+D ++RLG+  HF+ EI   L  ++  + +  + C  E+    L   +L  R  R +GY +S+DV N F   +G+F ++    +  ++RG+L+ + A+ +    E ++DEA  F++ +L
Sbjct:   52 ASTDSVQRRVGNYHSNLWDDDFIQSLISTPYGAPDYRERADRLIGEVKDIMFNFKSLEDGGNDLLQRLLLVDDVERLGIDRHFKKEIKTALDYVNSYWNEKGIGCGRESVVTDLNSTALGLRTLRLHGYTVSSDVLNVFKDKNGQFSSTANIQIEGEIRGVLNLFRASLVAFPGEKVMDEAETFSTKYL 240          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: TPSDB_ABIGR (Limonene/alpha-pinene synthase, chloroplastic OS=Abies grandis GN=ag11 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 9.601e-11
Identity = 48/195 (24.62%), Postives = 90/195 (46.15%), Query Frame = 2
Query:  116 NAGKDSTRGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAA----------NKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLC----DNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKF----MASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLESV 646
            N G    R  A+  P++W D F Q           + + + + +E++ M  +           N     L ++D+I+RLG+  HF+NEI   L  ++  +++ +      D+    L   +L  R  R +GY +S+DV   F    G F    + +  +  R +L+ Y A+ +    E +++EA  F++S+L+ V
Sbjct:   63 NGGGVLQRRIADHHPNLWEDDFIQSLSSPYGGSSYSERAVTVVEEVKEMFNSIPNNRELFGSQNDLLTRLWMVDSIERLGIDRHFQNEIRVALDYVYSYWKEKEGIGCGRDSTFPDLNSTALALRTLRLHGYNVSSDVLEYFKDQKGHFACPAILTEGQITRSVLNLYRASLVAFPGEKVMEEAEIFSASYLKEV 257          
The following BLAST results are available for this feature:
BLAST of FC920694 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
TPSD6_ABIGR2.526e-1125.93Camphene synthase, chloroplastic OS=Abies grandis ... [more]
TPSDB_ABIGR9.601e-1124.62Limonene/alpha-pinene synthase, chloroplastic OS=A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011H02EF RVDevelop1 Citrus clementina cDNA clone C32011H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920694 ID=FC920694|Name=FC920694|organism=Citrus clementina|type=EST|length=649bp
GGAATCAGCAAAGCTTTGGCTACCTTTTTTTTTCTCAAGACTCAATAGCC
TTCAGAAGTAATAGAAATTAAGTATGTCTTTAGAAGTTTCAGCCTCTCCT
GCTAAGGTCATCCAAAATGCTGGAAAAGATTCTACTCGTGGTTCTGCAAA
TTTTCCTCCAAGCATTTGGGGAGATCATTTCTTTCAATATACTTGTGACT
CCCAGGAAACTGATGATCAAAATGTAAAGCATCTAGAGCTGAAGAAAGAA
ATTAGAAGAATGCTGAAAGCTGCTAACAAGACTTCACATACACTTGAATT
GATAGATGCAATTCAGCGGTTAGGAGTGTCGTACCATTTTGAAAATGAGA
TTGATGAAATCTTGGGAAAGATGCACAAGACTTATCGAGACTGTGATCTT
TGTGATAATGAAAATGATGGGCTCTATTATATCTCTCTTCAGTTTCGATT
GTTCAGACAAAATGGCTATAGAATTTCCGCTGATGTTTTCAATGCGTTCA
TGGGAAGCGATGGGAAATTTATGGCATCTCTTGCAAAAGATGTTCGAGGA
ATGTTAAGCTTCTATGAAGCTACACATCTCAGGGTTCATGAAGAAAATAT
ACTAGATGAAGCGCTTGCTTTCACCTCTAGTCACCTTGAGTCAGTGGCA
back to top